KEGG   Bos taurus (cow): 444859Help
Entry
444859            CDS       T01008                                 

Gene name
ST3GAL3, SIAT6
Definition
ST3 beta-galactoside alpha-2,3-sialyltransferase 3 (EC:2.4.99.6)
Orthology
K00781  
N-acetyllactosaminide alpha-2,3-sialyltransferase (sialyltransferase 6) [EC:2.4.99.6]
Organism
bta  Bos taurus (cow)
Pathway
Other types of O-glycan biosynthesis
Glycosaminoglycan biosynthesis - keratan sulfate
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    444859 (ST3GAL3)
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    444859 (ST3GAL3)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    444859 (ST3GAL3)
Enzymes [BR:bta01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.6  N-acetyllactosaminide alpha-2,3-sialyltransferase
     444859 (ST3GAL3)
Glycosyltransferases [BR:bta01003]
 Terminal extension
  Sialyltransferase
   444859 (ST3GAL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
UniProt: 
Position
3
AA seq 374 aa AA seqDB search
MGPLIFVRNLLLALCLFLVLGFLYYSAWKLHLLQWEDSNSVVLSFDSAGQTLGSEYDRLG
FLLKLDSKLPAELATKYENFSEGTCKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARIR
EFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLSCRRCIIVGNGGVLANKSLGSRIDDY
DIVVRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKY
IVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPT
LGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYEAVRMAAIRESWTHNIQREKEFLRK
LVKARVITDLTSGI
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgggaccgttgatatttgttcgcaatctgctgctagccctctgcctctttctggtactg
ggatttttgtattattctgcatggaagctacatttactccagtgggaggactccaattca
gtggttctttcctttgactccgctggacaaacgctaggctcagagtatgaccggttgggc
tttctcctgaagctggactctaaactgcctgcagagttagccaccaagtacgaaaacttt
tcagagggaacctgcaagcctggctatgcttcggccttgatgactgccatcttcccccgg
ttctccaaaccagcacccatgttcctggatgactccttccgaaagtgggccaggatccgg
gaatttgtgccgccttttgggatcaaaggtcaagacaatctgatcaaagccatcttgtct
gtcaccaaagaataccgcctgacccccgccttggacagcctcagctgccgtcgctgcatc
atcgtgggcaacggaggtgtcctggccaacaagtctctggggtcgcgaattgatgactat
gacattgtggtcagactgaactcagcaccagtgaaaggctttgagaaggacgtgggcagc
aaaaccacactacgcatcacctaccccgagggcgccatgcaacggcctgagcagtacgaa
cgcgattccctctttgtcctcgctggcttcaagtggcaggacttcaagtggttgaaatac
atcgtctacaaggagagagtgagtgcctcggatggcttctggaaatctgtggctactcgg
gtgcccaaggaaccccccgagattcgcatcctcaacccatatttcatccaggaagctgcc
ttcaccctcatcggattgcctttcaacaacggtctcatgggccgcgggaacatcccgacc
ctcggcagtgtggcagtgaccatggcactacacggctgtgacgaggtggcagttgcaggc
ttcggctacgacatgagcacacccaatgcccccctgcactactatgaggccgtgcgcatg
gcagccatcagagagtcctggacgcacaacattcagcgagagaaagaatttctgcggaaa
ctggtgaaagcgcgtgtcatcactgacctcaccagtggtatctga

DBGET integrated database retrieval system