KEGG   Bos taurus (cow): 444869Help
Entry
444869            CDS       T01008                                 

Gene name
MOS, C-MOS
Definition
v-mos Moloney murine sarcoma viral oncogene homolog
Orthology
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
bta  Bos taurus (cow)
Pathway
MAPK signaling pathway
Oocyte meiosis
Regulation of actin cytoskeleton
Progesterone-mediated oocyte maturation
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:bta04010]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:bta04810]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:bta04114]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:bta04914]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Position
14
AA seq 340 aa AA seqDB search
MPSPLPRRPHLPGDLSPSSGDSRPCSSPCELLGRIPPRARRLRRRLAWCSIDWEQVCLLR
RLGAGGFGSVYEATYHGVRVAVKQVSRCSKNPRASRRSFWAELNAARLCHANIVRVLAAS
THPPPGFDSLGTVIMEFGGNITLHQVIYGPTGCPGDSGMQLGLERCLKYSLDVVSGLLFL
HAQSIVHLDLKPANILISEQDVCKIGDFGCSARLDDLRSPRTPHHLGGTYTHRAPELLKG
EPVTPKADIYSFAITLWQMSTREAPFSGERQHVLYAVVAYHLRPALRAPIFTDSVPRKTL
AGIVQRCWAALAPERPSAELLLGDLHALKEELGGLETGSR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgccctcgcccctcccgcggcgccctcacctgcccggcgacctctcgccgtcgtcgggg
gactcgcggccctgcagcagcccctgcgaactcttgggtcgcatcccgccgcgggcccgg
cgcctccggcgccggctggcctggtgttccatcgactgggagcaggtgtgtctgctacgg
aggctgggcgcgggtggctttggctcggtgtacgaggccacctaccacggcgtgcgcgtg
gccgtcaagcaggtgagccggtgctccaagaacccgcgggcgtcaaggcgcagcttctgg
gccgagctcaacgcggcccggctgtgccatgctaacatcgtgcgcgtgctggcggccagc
acgcacccgcccccgggttttgacagcctggggactgtcatcatggagttcgggggcaat
atcaccttgcaccaggtcatctacggccccaccggctgccccggggactcaggcatgcag
ctgggcttggagaggtgtctaaagtactccctagacgtggtcagcggcctgctgttcctc
cacgcgcaaagcattgtgcacttggacctcaagccggccaacatcctcatcagtgagcag
gacgtctgcaagatcggggacttcggctgctccgcgaggctggatgacctgcggagcccg
cgaacgcctcaccacctgggtggcacctacactcaccgagccccggagctcctcaaagga
gagcctgttacacccaaggccgacatctactccttcgccatcaccctctggcagatgagc
acgcgggaggcgcccttctcgggggagcggcagcacgtgctctacgccgtggtggcctac
cacctccggcccgccctccgggcacccatcttcaccgactcggtccccaggaagacgctg
gcgggcattgtccagcgctgctgggcggcccttgctcccgagaggccgagcgcagaactt
ctcttgggggacctccacgctttgaaagaggagctgggaggactcgagactggatccaga
taa

DBGET integrated database retrieval system