KEGG   Bos taurus (cow): 444869Help
Entry
444869            CDS       T01008                                 

Gene name
MOS, C-MOS
Definition
(RefSeq) MOS proto-oncogene, serine/threonine kinase
  KO
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
bta  Bos taurus (cow)
Pathway
Oocyte meiosis
Regulation of actin cytoskeleton
Progesterone-mediated oocyte maturation
Module
MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:bta00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    444869 (MOS)
  Cell motility
   04810 Regulation of actin cytoskeleton
    444869 (MOS)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    444869 (MOS)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     444869 (MOS)
Protein kinases [BR:bta01001]
 Serine/threonine protein kinases: Other group
  MOS family
   444869 (MOS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
BGD-bta: 
Ensembl: 
Position
14
AA seq 340 aa AA seqDB search
MPSPLPRRPHLPGDLSPSSGDSRPCSSPCELLGRIPPRARRLRRRLAWCSIDWEQVCLLR
RLGAGGFGSVYEATYHGVRVAVKQVSRCSKNPRASRRSFWAELNAARLCHANIVRVLAAS
THPPPGFDSLGTVIMEFGGNITLHQVIYGPTGCPGDSGMQLGLERCLKYSLDVVSGLLFL
HAQSIVHLDLKPANILISEQDVCKIGDFGCSARLDDLRSPRTPHHLGGTYTHRAPELLKG
EPVTPKADIYSFAITLWQMSTREAPFSGERQHVLYAVVAYHLRPALRAPIFTDSVPRKTL
AGIVQRCWAALAPERPSAELLLGDLHALKEELGGLETGSR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgccctcgcccctcccgcggcgccctcacctgcccggcgacctctcgccgtcgtcgggg
gactcgcggccctgcagcagcccctgcgaactcttgggtcgcatcccgccgcgggcccgg
cgcctccggcgccggctggcctggtgttccatcgactgggagcaggtgtgtctgctacgg
aggctgggcgcgggtggctttggctcggtgtacgaggccacctaccacggcgtgcgcgtg
gccgtcaagcaggtgagccggtgctccaagaacccgcgggcgtcaaggcgcagcttctgg
gccgagctcaacgcggcccggctgtgccatgctaacatcgtgcgcgtgctggcggccagc
acgcacccgcccccgggttttgacagcctggggactgtcatcatggagttcgggggcaat
atcaccttgcaccaggtcatctacggccccaccggctgccccggggactcaggcatgcag
ctgggcttggagaggtgtctaaagtactccctagacgtggtcagcggcctgctgttcctc
cacgcgcaaagcattgtgcacttggacctcaagccggccaacatcctcatcagtgagcag
gacgtctgcaagatcggggacttcggctgctccgcgaggctggatgacctgcggagcccg
cgaacgcctcaccacctgggtggcacctacactcaccgagccccggagctcctcaaagga
gagcctgttacacccaaggccgacatctactccttcgccatcaccctctggcagatgagc
acgcgggaggcgcccttctcgggggagcggcagcacgtgctctacgccgtggtggcctac
cacctccggcccgccctccgggcacccatcttcaccgactcggtccccaggaagacgctg
gcgggcattgtccagcgctgctgggcggcccttgctcccgagaggccgagcgcagaactt
ctcttgggggacctccacgctttgaaagaggagctgggaggactcgagactggatccaga
taa

DBGET integrated database retrieval system