KEGG   Bos taurus (cow): 444869Help
Entry
444869            CDS       T01008                                 

Gene name
MOS, C-MOS
Definition
v-mos Moloney murine sarcoma viral oncogene homolog
Orthology
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
bta  Bos taurus (cow)
Pathway
MAPK signaling pathway
Oocyte meiosis
Regulation of actin cytoskeleton
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    444869 (MOS)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    444869 (MOS)
  Cell growth and death
   04114 Oocyte meiosis
    444869 (MOS)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    444869 (MOS)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     444869 (MOS)
Protein kinases [BR:bta01001]
 Serine/threonine protein kinases: Other group
  MOS family
   444869 (MOS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
Position
14
AA seq 340 aa AA seqDB search
MPSPLPRRPHLPGDLSPSSGDSRPCSSPCELLGRIPPRARRLRRRLAWCSIDWEQVCLLR
RLGAGGFGSVYEATYHGVRVAVKQVSRCSKNPRASRRSFWAELNAARLCHANIVRVLAAS
THPPPGFDSLGTVIMEFGGNITLHQVIYGPTGCPGDSGMQLGLERCLKYSLDVVSGLLFL
HAQSIVHLDLKPANILISEQDVCKIGDFGCSARLDDLRSPRTPHHLGGTYTHRAPELLKG
EPVTPKADIYSFAITLWQMSTREAPFSGERQHVLYAVVAYHLRPALRAPIFTDSVPRKTL
AGIVQRCWAALAPERPSAELLLGDLHALKEELGGLETGSR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgccctcgcccctcccgcggcgccctcacctgcccggcgacctctcgccgtcgtcgggg
gactcgcggccctgcagcagcccctgcgaactcttgggtcgcatcccgccgcgggcccgg
cgcctccggcgccggctggcctggtgttccatcgactgggagcaggtgtgtctgctacgg
aggctgggcgcgggtggctttggctcggtgtacgaggccacctaccacggcgtgcgcgtg
gccgtcaagcaggtgagccggtgctccaagaacccgcgggcgtcaaggcgcagcttctgg
gccgagctcaacgcggcccggctgtgccatgctaacatcgtgcgcgtgctggcggccagc
acgcacccgcccccgggttttgacagcctggggactgtcatcatggagttcgggggcaat
atcaccttgcaccaggtcatctacggccccaccggctgccccggggactcaggcatgcag
ctgggcttggagaggtgtctaaagtactccctagacgtggtcagcggcctgctgttcctc
cacgcgcaaagcattgtgcacttggacctcaagccggccaacatcctcatcagtgagcag
gacgtctgcaagatcggggacttcggctgctccgcgaggctggatgacctgcggagcccg
cgaacgcctcaccacctgggtggcacctacactcaccgagccccggagctcctcaaagga
gagcctgttacacccaaggccgacatctactccttcgccatcaccctctggcagatgagc
acgcgggaggcgcccttctcgggggagcggcagcacgtgctctacgccgtggtggcctac
cacctccggcccgccctccgggcacccatcttcaccgactcggtccccaggaagacgctg
gcgggcattgtccagcgctgctgggcggcccttgctcccgagaggccgagcgcagaactt
ctcttgggggacctccacgctttgaaagaggagctgggaggactcgagactggatccaga
taa

DBGET integrated database retrieval system