KEGG   Bos taurus (cow): 493992Help
Entry
493992            CDS       T01008                                 

Gene name
ST6GAL2, SIAT2, ST6Gal_II, ST6GalII
Definition
(RefSeq) ST6 beta-galactoside alpha-2,6-sialyltransferase 2
  KO
K00779  beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 2) [EC:2.4.99.1]
Organism
bta  Bos taurus (cow)
Pathway
bta00510  N-Glycan biosynthesis
bta00514  Other types of O-glycan biosynthesis
bta01100  Metabolic pathways
Module
bta_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    493992 (ST6GAL2)
   00514 Other types of O-glycan biosynthesis
    493992 (ST6GAL2)
Enzymes [BR:bta01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-(2,6)-sialyltransferase
     493992 (ST6GAL2)
Glycosyltransferases [BR:bta01003]
 Terminal extension
  Sialyltransferase
   493992 (ST6GAL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 493992
NCBI-ProteinID: NP_001008668
BGD-bta: BT11087
Ensembl: ENSBTAG00000000703
UniProt: A5D7T4
Position
11
AA seq 495 aa AA seqDB search
MKPHLKQWRQGMLCGVFAWGLFFVVIFLYFTDSSPAKPAPSSFSFLETRRLLPAQGRQRA
IMGASEGLPEGADLRRGSPRGLPSGPLRTWAGDGFEREQEFLSVQTGRTSLSSFAPEDSA
PGTSGRLFPGDPGPEGARPPRAAPGRRAKRGPRRQSLSARGEDGERLYSSMSRALLRRLW
KGDASARMLHPRLQKAMGAYLRANKHGVRFRGRRASGRSRTELLCALRGRVQVRTLDGTE
PPFSALGWRALVPPVPLSRLLPRRLRTCAVVTSAGAILNSSLGEEIDSHDAVLRFNSAPT
RGYEKDVGNKTTVRIINSQILTNPSYHFMDSALYKDVILVAWDPAPYSANLNLWYKKPDY
NLFTPYVQHRQRNPNQPFYILHPKFIWQLWDIIQENTKEKIQPNPPSSGFIGILLMMNLC
GEVHVYEYVPSVRQTDLCHYHEPYHDAACTLGAYHPLLYEKLLVQRLNVGTHGDLHRKGK
VVLPGLQAVRCPPGA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgcacctgaagcaatggagacaaggaatgctctgcggggtgtttgcatggggg
ctcttctttgtggtgatcttcctctacttcaccgacagcagcccagccaagcctgcgccc
agctccttctcctttctggagacccggaggctgctgcccgcacaagggaggcagcgggcc
attatgggggcctcagagggcctgcccgagggcgcggacttgcggcgggggtctccccgg
ggactcccatctggccccctgcggacatgggccggagatggctttgaacgtgaacaagag
tttctttcggtccagacagggagaacgtccctaagctcttttgccccggaggactccgct
ccgggcacgtcggggcgcctcttccctggggacccaggcccggagggggctcggccgcca
cgcgcagcccccggacggcgggcaaagcgagggccacggaggcaaagcctgagcgcgcgg
ggcgaggacggggagcggctgtactcgtccatgtcccgggccttgctgcgacggctctgg
aagggcgatgcgtcggcgcgcatgctgcacccgcgtctgcagaaggccatgggtgcctac
ctgcgcgccaacaagcacggcgtgcgcttccgggggcgccgcgcatccgggcggagccgc
accgagctgctgtgcgcgttgcggggccgcgtgcaggtgcgcaccctggacggcactgag
ccgcccttctcggcactcggctggcgcgcactggtccctccggtgccactcagccggctg
ctcccgcgcaggctccggacctgcgccgtggtcacgtcggcaggcgccatcctcaactca
tctctgggcgaggagatagattcccatgatgcggttttgaggtttaactctgctcctaca
cgtggctacgagaaagatgtcggaaataaaaccaccgtccgcatcattaattcccagatt
ctaaccaaccccagctaccacttcatggacagtgcattgtataaagatgtcatcttggtg
gcctgggacccagctccttattctgcaaatcttaacctgtggtacaagaagccagattac
aacctgttcacaccgtatgttcagcatcgtcagagaaacccgaaccagccattttacatt
cttcaccccaagtttatctggcagctttgggacatcatccaggagaacacgaaggagaag
atccagcccaacccgccgtcctctggctttatcggcatcctgctgatgatgaacctgtgt
ggcgaggtgcacgtgtacgaatacgtcccgtcagtgcggcagacagacctgtgtcactac
cacgagccctaccatgacgccgcctgcacactgggcgcctaccacccgctgctctacgag
aagctgctggtgcagcggctcaacgtgggcacccatggtgacctgcaccgcaaaggcaag
gtcgtgctgcccgggttgcaggccgtgcgctgcccgccaggtgcctga

DBGET integrated database retrieval system