KEGG   Bos taurus (cow): 497026Help
Entry
497026            CDS       T01008                                 

Gene name
PLCZ1, PLCZ
Definition
phospholipase C, zeta 1 (EC:3.1.4.11)
Orthology
K05861  
phosphatidylinositol phospholipase C, zeta [EC:3.1.4.11]
Organism
bta  Bos taurus (cow)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Oocyte meiosis
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    497026 (PLCZ1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    497026 (PLCZ1)
   04070 Phosphatidylinositol signaling system
    497026 (PLCZ1)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    497026 (PLCZ1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    497026 (PLCZ1)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     497026 (PLCZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
5
AA seq 634 aa AA seqDB search
MENKWFLLMVRDDFKGGKITLEKALKLLEKLDIQCNTIHVKYIFKDNDRLKQGRITIEEF
RTIYRIITYREEIIEIFNTYSENRKILLEKNLVEFLMREQYTLDFNKSIASEIIQKYEPI
EEVKQAHQMSFEGFRRYMDSSECLLFDNKCDHVYQDMTHPLTDYFISSSHNTYLISDQLW
GPSDLWGYISALVKGCRCLEIDCWDGSQNEPVVYHGYTFTSKLLFKTVIQAINKYAFLAS
EYPVVLSLENHCSPSQQEVMADSLLATFGDALLSYTLDNFSDRLPSPEALKFKILVRNKK
IGTLHETLERKGSDMHGKVEEFEEEEEIEQEEDGSGAKEPEPVGDFQDDLAKEEQLKRVV
GIPLFRKKKIKISMALSDLVIYTKVEKFKSFHHSHLYQQFNESNSIGESQARKLTKLAAR
EFILHTRRFITRVYPKALRADSSNFNPQEFWNVGCQMVALNFQTPGVPMDLQNGKFLDNG
CSGYVLKPRFLRDKKTKFNPHKVQIDSNPLTLTIRLISGIQLPPSYQNKADTLVIVEIFG
VPNDQMKQQSRVIKKNAFNPRWNETFTFVIQVPELALIRFVAENQGLIAGNEFLGQYTLP
VLCMNRGYRRVPLFSKMGESLEPASLFIYVWYIR
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atggagaacaaatggtttttgttgatggttcgagatgacttcaaaggtggaaaaattact
ctagaaaaagctctgaaactacttgaaaaattagatattcagtgcaatactattcatgtg
aaatatatttttaaggataatgacaggctgaaacaaggaagaatcaccatagaagaattt
agaacaatttatcgaattattacatacagagaagaaattattgagattttcaacacgtat
tctgaaaaccggaaaattcttttagaaaagaacctggtcgaatttttgatgcgagaacag
tatacacttgacttcaataaaagtattgcttctgagatcattcagaaatatgagcctatt
gaagaagttaaacaagcacaccagatgtcatttgaaggttttagaagatacatggattca
tctgaatgtctgctatttgataataagtgtgatcatgtttaccaagatatgactcatcca
ttgactgattattttatttcaagttcacataatacatacttgatatctgaccaattatgg
ggaccaagtgacctttggggatatataagtgcccttgtgaaaggatgccgctgtctggaa
attgactgctgggatggatcacaaaatgaacctgttgtataccatggctatacattcacc
agcaagcttctgtttaaaactgttatccaagctataaacaaatatgcattcctagcatct
gagtacccagtggtgctctctttagaaaatcactgctccccttcccaacaagaagtgatg
gccgacagtttgctcgctacatttggggatgccttgctgtcatatacgcttgataatttt
tcagacagactaccttcaccagaggcattaaaattcaaaatattagttagaaacaagaaa
ataggaaccttacatgaaacccttgaaaggaaaggttctgatatgcatgggaaggtagag
gaatttgaagaagaggaggagatagaacaagaggaggatggaagtggtgccaaagaacca
gaaccagtgggtgattttcaagatgatttggcaaaggaagaacagttgaaacgggtggtc
ggaatcccactcttcaggaaaaagaagataaaaatatctatggccctatctgatcttgtt
atttatactaaagttgagaagttcaaaagttttcatcattcacatctatatcaacaattt
aatgaaagcaactctattggggagtcccaagcccgaaaacttacaaagttggcagccagg
gaatttattcttcacaccaggaggttcattaccagagtatatcccaaagcattaagagct
gactcttctaattttaatcctcaagaattttggaatgtaggttgtcaaatggtggcctta
aatttccagacccctggtgtccctatggatcttcaaaatgggaaatttttggataatggt
tgttctggatatgttttaaaaccacgcttcctaagagataaaaaaacaaagtttaatcca
cataaagtacaaatagacagtaatccactcacacttacaataaggctcatcagtggtatc
cagttgcctcccagttatcaaaacaaagctgataccttagtgattgtagaaatttttggg
gttccaaatgatcaaatgaagcagcagagtcgtgtaattaaaaaaaatgcttttaatcca
agatggaatgaaacattcacatttgttattcaggtgccagaattagcattgattcgtttt
gttgctgaaaatcaaggtttaatagctggaaatgaatttcttggacaatatactttacca
gttctatgcatgaacagaggttaccgtcgtgttcctctgttttccaaaatgggtgagagt
cttgagcccgcttccctttttatttatgtttggtacatcagatag

DBGET integrated database retrieval system