KEGG   Bos taurus (cow): 503552Help
Entry
503552            CDS       T01008                                 

Gene name
CYP1A2
Definition
cytochrome P450, family 1, subfamily A, polypeptide 2
Organism
bta  Bos taurus (cow)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
Position
21
AA seq 516 aa AA seqDB search
MALSQLSPFSAMELLLASAIFCLVFWVVRTWRPRVPQGLKSPPEPWGWPLLGHMLTLGKN
PHVVLSQLSQRYGDVLQIRIGCTPVLVLSGLDTVRQALVRQGDDFKGRPDLYSFTLVTDG
QSMTFNPDSGPVWAARRRLAQNALNTFSVASDPSSSSSCYLEDHVSKEAEALLGKFQELM
SGPGRFDPYGHVVASVANVIGAMCFGQHFPQSSKEMLSLVESSHDFVESASSGNPVDFFP
ILKYLPNPALQRFKSFNQRFLQFVRKTVQEHYQDFDKNSIQDIIGALFKHSEDNSRASSR
LISQEKTVNLVNDLFAAGFDTITTAISWSLMYLVTNPKIQRKIQEELDRVVGRARRPRLS
DRPQLPYLESFILETFRHSSFVPFTIPHSTTRDTTLNGFFIPKERCVFINQWQVNHDPKL
WGDPSVFRPERFLTSDGTTIDKTASEKVLLFGMGKRRCIGEVMARWEVFLFLAILLQRLE
FSVPPGVKVDLTPTYGLTMKHARCEHMQARLRFPIK
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggcattgtcccaactcagtcccttctcagccatggagcttctcctggcctctgccatc
ttctgcctggtattctgggtggtcaggacctggcggcctcgggtccctcaaggcctgaag
agtccaccggagccctggggctggcctctgcttgggcacatgctgacgttggggaagaac
ccgcacgtggtcctgtcgcagctgagccagcgctatggggacgtgctgcagatccgcatt
ggctgcacacccgtgctggtgctcagcggcctggacaccgtccggcaggccctcgtgcgg
cagggcgatgatttcaagggccggcccgacctctacagcttcaccttggtcactgatggc
cagagcatgaccttcaacccagactctggaccagtgtgggctgcccggcgacgcctggcc
cagaatgctctcaacaccttctctgtggcctcagacccatcttcctcctcctcctgctac
ctggaggatcatgtgagcaaggaggctgaggccctcctgggcaagttccaggagctgatg
tcagggcctgggcgcttcgacccctatggccatgtggtggcatcagtggccaacgtcatc
ggtgccatgtgcttcgggcagcacttcccccagagcagtaaggagatgctcagtctggtg
gagagcagccatgatttcgtggaatccgccagctccgggaatcctgtggacttcttccct
atccttaaatacctgcccaacccggctctgcaaaggttcaagagcttcaaccagaggttc
ctgcagttcgtgcggaaaacggtccaggagcactaccaggactttgacaagaacagcatc
caggacatcataggcgccctgttcaagcacagtgaggataactcccgagccagcagtcgc
ctcatctcccaggagaagactgtcaaccttgtcaacgacctctttgcggctgggtttgac
accatcacaacagccatctcctggagccttatgtaccttgtgacaaatcctaagatacag
agaaagatccaggaggagctggacagagtggttggcagggcacggcggccccggctctcc
gacagaccccagctgccctatttggagtccttcatcctggagaccttccgacactcctcc
ttcgtccccttcaccatcccacacagcacaacaagggatacgacactgaatggcttcttc
atacccaaggaacgctgtgtcttcataaaccagtggcaggtcaaccatgacccgaagctg
tggggggacccatctgtgttccggccagagagattcctcacgtctgatggcaccaccatt
gataagacggcaagcgagaaagtgttactcttcggcatgggcaagcgccggtgcataggg
gaggtcatggccaggtgggaggtcttcctcttcctggccatcttgctgcagcggctggag
ttcagcgtgccaccaggtgtgaaagtggacctaacccccacctatgggctgaccatgaag
catgcccgctgtgagcacatgcaggcacggctgcgcttccccatcaagtga

DBGET integrated database retrieval system