KEGG   Bos taurus (cow): 504241Help
Entry
504241            CDS       T01008                                 

Gene name
CTRB1
Definition
chymotrypsinogen B1 (EC:3.4.21.1)
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
bta  Bos taurus (cow)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
18
AA seq 263 aa AA seqDB search
MAPLWLLSCFALVGAAFGCGVPAIQPVLSGLARIVNGEDAVPGSWPWQVSLQDSTGFHFC
GGSLISEDWVVTAAHCGVTTSDVVVAGEFDQGLQTEDTQVLKIGKVFKNPKFSILTVRND
ITLLKLATPAQFSETVSAVCLPSADEDFPAGMLCATTGWGKTKYNALKTPDKLQQATLPI
VSNTDCRKYWGSRVTDVMICAGASGVSSCMGDSGGPLVCQKNGAWTLAGIVSWGSSTCST
STPAVYARVTALMPWVQETLAAN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcccctctctggctcctctcctgttttgcccttgtaggggccgccttcggctgcgga
gtccccgccatccagcctgtgctgagtggcctcgccaggatcgtcaacggggaggacgcc
gtgcccggctcctggccctggcaggtgtccctgcaggacagcaccggcttccacttctgc
gggggctccctcatcagtgaggactgggtggtcaccgccgcccactgcggggtcacaacc
tctgacgtggttgtggccggggagtttgatcagggcttacagaccgaggacacccaggtc
ctgaagattggcaaggttttcaagaaccccaagttcagcattctcacagtccgcaatgac
atcaccctgctgaagctggccacgcccgcgcagttctcagagaccgtgtcggccgtgtgc
ttgcccagtgccgacgaggacttccccgctgggatgctgtgcgccaccacgggctggggc
aagaccaagtataacgccctcaagacccctgacaagctgcagcaggccaccctgcccatc
gtgtccaacaccgactgcaggaagtactggggcagcagggtcaccgatgtgatgatctgt
gcgggggccagcggcgtctcctcctgcatgggcgactctggcggccccctggtctgccag
aagaacggagcctggaccctggcgggcatcgtgtcctggggcagcagcacgtgctccacg
tccacgcccgccgtgtacgcccgcgtcactgcacttatgccgtgggtgcaggagaccctg
gctgccaactga

DBGET integrated database retrieval system