KEGG   Bos taurus (cow): 504242Help
Entry
504242            CDS       T01008                                 

Gene name
HDAC5
Definition
histone deacetylase 5 (EC:3.5.1.98)
Orthology
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
bta  Bos taurus (cow)
Pathway
Alcoholism
Epstein-Barr virus infection
Viral carcinogenesis
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:bta05203]
Human Diseases; Substance dependence; Alcoholism [PATH:bta05034]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:bta05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
19
AA seq 1125 aa AA seqDB search
MNSPTESDGMPGREPALEILPRTPLHGIPVTVEVKPVLPGAMPSSMGGGGGGSPSPVELR
GALAGPVDPTLREQQLQQELLALKQQQQLQKQLLFAEFQKQHDHLTRQHEVQLQKHLKVS
VGARAPKQQQEMLAAKRQQELEQQRQREQQRQEELEKQRLEQQLLILRNKEKSKESAIAS
TEVKLRLQEFLLSKSKEPTPGGLNHSLPQHPKCWGTHHASLDQSSPPQSGPPGTPSSYKL
PLLGPYDSRDDFPLRKTASEPNLKVRSRLKQKVAERRSSPLLRRKDGTVISTFKKRAVEI
TGAGPGVSAVCNSAPGSGPSSPNSSHSTIAENGFTGSVPNIPTEMLPQHRALPPDTSPNQ
FSLYTSPSLPNISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSLRQGGALTGKFMST
SSIPGCLLGVALEGDSSPHGHASLLQHVLLLEQARQQSTLIAVPLHGQSPLVTGERVATS
MRTVGKLPRHRPLSRTQSSPLPQSPQALQQLVMQQQHQQFLEKQKQQQLQLGKILTKTGE
LPRQPTTHPEETEEELTEQQDALLGEGALTIPREGSTESESTQEDLEEEEEEEEEEEEEE
EEDCIQVKDEERESGAEEGPDLEESSAGYKKAFADTQQLQPLQVYQAPLSLATVPHQALG
RTQSSPAAPGGMKSPPDQPTKHLFTTGVVYDTFMLKHQCMCGNTHVHPEHAGRIQSIWSR
LQETGLLSKCERIRGRKATLDEIQTVHSEYHTLLYGTSPLNRQKLDSKKLLGPISQKMYA
MLPCGGIGVDSDTVWNEMHSSSAVRMAVGCLVELAFKVAAGELKNGFAIIRPPGHHAEES
TAMGFCFFNSVAITTKLLQQKLNVGKVLIVDWDIHHGNGTQQAFYNDPSVLYISLHRYDN
GNFFPGSGAPEEVGGGPGVGYNVNVAWTGGVDPPIGDVEYLTAFRTVVMPIAHEFSPDVV
LVSAGFDAVEGHLSPLGGYSVTARCFGHLTRQLMTLAGGRVVLALEGGHDLTAICDASEA
CVSALLSVELQPLDEAVLQQKPNINAVATLEKVIEIQSKHWSCVQRFAAGLGRSLREAQA
GETEEAETVSAMALLSVGAEQAQAAAAREHSPRPAEEPMEQEPAL
NT seq 3378 nt NT seq  +upstreamnt  +downstreamnt
atgaactctcccaccgagtcggatgggatgccaggccgggaaccagccttggaaatcctg
ccccggacccctctgcacggcatccccgtgacagtagaggtgaaaccggtgctgccagga
gccatgcccagctccatggggggcgggggaggaggcagccccagccccgtggagctgcgg
ggggctctggcaggccctgtggaccccacgctgcgggagcagcaactgcagcaggagctc
ctggcactcaagcagcagcagcaactgcagaagcagcttctgttcgctgagttccagaag
cagcatgaccacctgacccggcagcatgaagtccagctgcagaagcacctcaaggtgagc
gtgggggccagggcacccaagcagcagcaggagatgctggcagccaagaggcagcaggag
ctggagcagcagcggcagcgggagcagcagcggcaggaggagctggagaagcagcggctc
gagcagcagctgctcatccttcgaaacaaggagaagagcaaagagagtgccatcgccagc
actgaggtgaagctacggctccaggaattcctcctgtcgaagtcaaaggagcccacacca
ggcggcctcaaccattccctcccacagcatcccaaatgctggggaacccaccatgcttct
ttggaccagagttcccctccccagagcggcccccctgggacgccttcctcctacaaactg
cctttgcttgggccctacgacagccgcgatgacttccccctccgcaaaacagcctccgaa
cccaacttaaaagtacgttcgaggctaaagcagaaggtggccgagcggagaagcagtccc
ctcttgcgtcgcaaggatgggactgtcattagcacctttaagaagagagctgttgagatc
acaggtgccggacctggggtgtccgccgtgtgtaacagcgcaccaggctctggccccagc
tctcccaacagttcccacagcaccatcgcggagaatggctttacgggctcggttcccaac
atccccaccgagatgctcccccagcaccgggccctccctccggacacctcccccaaccag
ttcagcctctacacgtctccctctctgcccaacatctccctagggctgcaggccacggtc
actgtcaccaactcgcacctcaccgcctccccgaagctgtcgacgcagcaggaggccgag
aggcaggccctccagtccctgcggcagggcggtgcactgacgggcaagttcatgagcaca
tcctccatccctggctgcctgctgggcgtggcactggagggcgactcgagcccccacggg
catgcctcactgctgcagcacgtgctgctgctggaacaagcccggcagcagagcaccctc
attgctgtgccgctccacgggcagtccccgctggtgacgggtgagcgcgtggccaccagc
atgcggacagtgggcaagctcccgcggcaccggcccctgagccgcacccaatcctcgccg
ctgccccagagcccccaggccctgcagcagctggtcatgcagcagcagcaccagcagttc
ctggagaagcagaagcagcagcagctgcagctgggcaagatccttaccaagacgggggag
ctgccacggcagcccaccacccaccccgaggagacagaggaggagctgacggagcagcag
gacgccttgctgggggagggagccctgaccataccccgagaaggctccacggagagtgag
agcacccaggaagacctggaggaggaggaagaggaggaggaggaagaggaggaggaggag
gaggaggactgcatccaggtcaaggacgaggagcgcgagagcggtgctgaagaggggccc
gacttggaggagtccagtgctggttacaaaaaggcatttgcagacacccagcagctgcag
ccgctgcaggtgtaccaggcacccctcagcctggccactgtgccccaccaggccctgggc
cgcacccagtcctcacctgctgcccctgggggcatgaagagccccccagaccagcccact
aagcacctcttcaccacaggtgtggtctacgacacgttcatgctgaagcaccagtgcatg
tgtgggaacacacacgtgcaccccgagcacgctggccggatccagagcatctggtcccgg
ctgcaggagacaggcctgctcagcaagtgtgagcgaatccggggtcgtaaagccacgctg
gatgagatccagacggtgcactccgagtaccacaccctgctgtacggtaccagccccctc
aaccggcagaagctggacagcaagaagctgctcggccccatcagccagaagatgtacgcc
atgctgccttgcgggggcattggggtggacagcgacactgtgtggaacgagatgcactcc
tccagcgccgtgcgcatggccgtgggctgcctggtggagctggcattcaaggtggctgca
ggggagctcaagaatggatttgccatcatccggcccccaggacaccacgcggaggaatcc
acagccatgggattctgcttcttcaactcagtagctatcacaaccaagctcctgcagcag
aagttgaacgtgggcaaggttctcatcgtggactgggacattcaccatggcaatggcacc
cagcaagcattttacaacgatccctctgtgctctacatctccctgcatcgctatgacaac
gggaacttctttccgggctctggggctcctgaagaggttggcggagggccgggcgtgggg
tacaatgtgaacgtggcatggacgggaggtgtggacccccccatcggagacgtggagtac
ctaacggccttcaggacagtggtgatgcccattgcccacgagttctcacctgatgtggtc
ctggtctccgctggctttgatgctgttgagggacacctgtctccgctgggtggctactct
gtcaccgccagatgttttggccacttgaccaggcagctgatgacgctggcagggggccgg
gtggtgctggccctggagggaggccacgacctgaccgccatctgtgatgcctctgaggcc
tgtgtctcggcgctgctcagcgtggagctgcagcccttggacgaggcagtcttgcagcaa
aagcccaacatcaacgcagtggccacgctggagaaagtcatcgagatccagagtaaacac
tggagctgtgtgcagaggttcgctgctggcctaggccgttccctgcgggaggcccaggca
ggtgagacagaggaggctgagactgtgagcgccatggccttgctgtcggtgggggccgag
caggcccaggcggctgcagcccgggagcacagccccaggccagcagaggagcctatggaa
caggagcctgccctgtga

DBGET integrated database retrieval system