KEGG   Bos taurus (cow): 504261Help
Entry
504261            CDS       T01008                                 

Gene name
CAD
Definition
carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase (EC:2.1.3.2)
Orthology
K11540  
carbamoyl-phosphate synthase / aspartate carbamoyltransferase / dihydroorotase [EC:6.3.5.5 2.1.3.2 3.5.2.3]
Organism
bta  Bos taurus (cow)
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bta00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bta00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
11
AA seq 2225 aa AA seqDB search
MAALVLEDGSVLRGQPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILVLTYPLIGNY
GIPPDEVDEFGLSKWFESSGIHVAGLVVGECCPTPSHWSASCTLHEWLQQHGIPGLQGVD
TRELTKKLREQGSLLGKLVQDGTEPSTLPFLDPNARPLVPEVSTKVPQVFNAGGTPRILA
LDCGLKYNQVRCLCQRGAEVTVVPWDHALDSQEYEGLFLSNGPGDPASYPNLVSTLSRVL
SEPNPRPVFGICLGHQLLALAIGAKTYKMRYGNRGHNQPCLLVGSGRCFLTSQNHGFAVE
TDSLPASWLPLFTNANDHSNEGIVHESLPFFSVQFHPEHQAGPSDMELLFDIFLETVKET
AAGNPGGQTVRERLAERLCLLGIPTPGSGLTAPRKVLILGSGGLSIGQAGEFDYSGSQAI
KALKEENIQTLLINPNIATVQTSQGLADKVYFLPITPHYVTQVIRNERPDGVLLTFGGQT
ALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFASRMAEIGEHVAPSEAANSLEQ
AQAAAERLGYPVLVRAAYALGGLGSGFASNKEELSALVAPAFAHTSQVLVDKSLKGWKEI
EYEVVRDAYGNCVTVCNMENLDPLGIHTGESIVVAPSQTLNDREYQLLRQTAIKVTQHLG
IVGECNVQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPELRN
SVTGGTAAFEPSLDYCVVKIPRWDLSKFLRVSTKIGSCMKSVGEVMGIGRSFEEAFQKAL
RMVDENCVGFDHTVKPVSDMELETPTDKRIFVVAAALWAGYSVDRLYELTRIDRWFLHRM
KRIIAHTQLLEQHRGQPLPPDLLHQAKRLGFSDKQIALAVLSTELAVRKLRQELGICPAV
KQIDTVAAEWPAQTNYLYLTYWGTTHDLTFRTPHVLVLGSGVYRIGSSVEFDWCAVGCIQ
QLRKMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGGQLP
NNMAMALHRQQCRVLGTSPEAIDSAENRFKFSRLLDTIGISQPQWRELSDLESARQFCQT
VGYPCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAV
ACDGVVAAIAISEHVENAGVHSGDATLVTPPQDITAKTLERIKAIVHAVGQELQVTGPFN
LQLIAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATRVIMREEVEPVGLMTGSGVVG
VKVPQFSFSRLAGADVVLGVEMTSTGEVAGFGESRCEAYLKAMLSTGFKIPKKNILLTIG
SYKNKSELLPTVRLLESLGYSLYASLGTADFYTEHGVKVTAVDWHFEEAVDGESPPQRSI
LEQLAEKNFELVINLSMRGAGGRRLSSFVTKGYRTRRLAADFSVPLIIDIKCTKLFVEAL
GQIGPAPPLKAHVDCMTSQKLVRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGVTMV
CAMPNTRPPITDAPALALAQKLAEAGARCDYALFLGASSENAGTLGTVAGSAAGLKLYLN
ETFSKLRLDSVAQWMEHFETWPSHLPIVAHAERQSVAAVLMVAQLAQRSVHICHVARKEE
ILLIKAAKARGLPVTCEVAPHHLFLSHDDLERLGPGKGEVRPKLGSREDVEALWENMAII
DCFASDHAPHTVEEKCGPRPPPGFPGLETMLPLLLTAVSEGRLSLDDVLQRLHHNPRRIF
HLPPQEDTYVEVDLEHEWTVPSHMPFSKAHWTPFEGQKVKGTIRRVVLRGEVAYIDGQVL
VPPGYGQDVRKWPQGAVPQLTPSAPAASELTTTPERPRRSGPALPDGRFHLPPRIHRASD
PGLPAEEPKEKTSRKAAEPELMGTLDGICYPPPPVPRQASPQNLGTPGLLHPQTSPLLHS
LVGQHILSVQQFTKDQMSHLFNVAHTLRMMVQKERSLDILKGKVMASMFYEVSTRTSSSF
AAAMARLGGAVLSFSEATSSVQKGESLADSVQTMSCYADVVVLRHPQPGAVELAAKHCRR
PVINAGDGVGEHPTQALLDIFTIREELGTVNGMTITMVGDLKHGRTVHSLACLLTQYRVS
LRYVAPPSLRMPPDVRAFVASRGTKQEEFESIEEALPDTDVLYMTRIQKERFGSTQEYEA
CFGQFILTPHIMTRAKKKMVVMHPMPRVNEISVEVDSDPRAAYFRQAENGMYIRMALLAT
VLGRF
NT seq 6678 nt NT seq  +upstreamnt  +downstreamnt
atggccgccctggtgttggaggacgggtcggtcctgcggggccagccctttggggccgct
gtgtcgactgccggggaagtggtgtttcaaaccggtatggtcggctaccccgaggccctg
actgacccttcctacaaagcacagatcttagtgctgacataccctctgatcggtaactac
ggaatccccccggatgaagtggatgagttcgggctcagcaagtggtttgaatcctcgggg
atccacgtggcaggactggtggtgggagagtgctgtcccacacccagccactggagtgcc
agctgcactctgcacgagtggctgcaacaacatggcatacccggcctgcaaggagtggac
actcgggagctgactaagaagctgcgagagcaagggtctctgctgggcaagttggtccag
gatgggacagaaccttcaaccctgcccttcttggaccccaatgcccgccccctggtgcca
gaggtctccactaaggttccccaggtattcaacgcagggggtacccctcggatccttgct
ttggactgtggcctcaagtataatcaggtccgatgcttgtgccagcgtggggcagaggtc
actgtggtaccctgggaccacgcgttagacagtcaagagtatgagggtctcttcctgagt
aatggccctggtgaccctgcctcctatcccaacttggtatccacactgagccgtgtttta
tctgaaccaaacccccgacctgtcttcgggatctgtctgggacaccagcttttggcctta
gccattggggccaagacttacaagatgagatatgggaaccgaggccataaccagccatgc
ttgctggtgggctctgggcgctgctttctaacatcccagaaccatggatttgctgtggaa
acagactcgctgccagcaagctggcttcctctcttcaccaatgccaatgatcactccaac
gaaggcatcgtacatgagagcctgcccttcttcagtgtccagtttcacccagagcatcaa
gctggcccttcagatatggaacttctttttgacatttttctggaaactgtgaaagaaact
gcagctggaaaccctgggggccagacagttcgagagcggctggctgagcgcctctgtctc
cttgggattcccaccccaggctctgggcttacagcaccacgaaaggttctgattctgggc
tcagggggcctctccatcggccaggccggcgagtttgactactcaggctctcaggcgatc
aaggccctgaaggaggaaaacattcagacattgctgatcaaccctaacatcgctaccgtg
cagacttcacaggggctggcggacaaggtctatttcctccccataacacctcactacgta
acccaggtgatacgtaatgagcgcccagatggtgtgttactgacttttgggggccaaaca
gctctgaactgtggtgtggagctgaccaaggctggggtgcttgctcggtacggagtccgg
gtcctgggcacacccgtggagaccattgagttgactgaagatcggcgtgccttcgcctcc
aggatggcagagatcggagagcatgtggcccccagcgaggcagcgaattctcttgagcag
gcccaggcagctgctgagagactgggataccctgtgctggtgcgcgcagcctacgccttg
ggtggcctgggctctggctttgcctctaacaaagaggagttgtctgctctcgtggcccca
gcttttgcccataccagccaagtgctggtagataagtccctgaaaggatggaaggagatt
gagtatgaggtggtgagagatgcctatggcaactgtgtcacggtgtgtaacatggagaac
ctagacccgctgggcatccacaccggggagtccatcgtggtggctccaagccagacgcta
aatgacagggagtaccagctgctgaggcagacggccatcaaggtgactcagcacctcgga
atcgtcggggagtgcaacgtgcagtatgccctgaaccctgagtctgagcagtactacatc
attgaagtgaatgccaggctctctcgcagctctgccctagccagtaaggccacaggctac
ccactggcctatgtggcagccaagctggctttgggcatccctctgcctgaactcaggaac
tctgtgacagggggaacggcagcctttgaacccagtctggattactgtgtggtgaagatt
cctcgctgggacctcagcaagttcctccgcgtcagcacaaagattgggagctgcatgaag
agcgtgggtgaagtcatgggcattgggcgttcttttgaggaggccttccagaaggctctg
cgcatggtggatgagaactgcgtgggctttgatcacacggtcaagcccgtcagtgatatg
gagttagagactccaacagacaagcgcatcttcgtggtggcagcagccctatgggctggc
tactcagtggatcgcctgtatgaactcactcgcatcgaccgctggttcctgcaccggatg
aagcggatcatagcacacacccagctgctagagcaacaccgtggacaacctttgccccca
gacctgcttcatcaggccaagcgccttggcttctcagacaagcagattgccctcgcggtc
ctcagcacagagctggctgttcgcaagctgcgtcaggaactagggatctgcccagcagtg
aagcagattgacacggttgcagctgagtggccggcccagacaaattacttgtacctgaca
tactggggcaccacccatgacctcacctttcgaacaccccatgtcctagtccttggctct
ggcgtctaccgtatcggctccagcgtcgagtttgactggtgtgccgtgggctgtatccag
cagctgcgaaagatggggtataagaccatcatggtgaactacaacccagagacagtcagc
accgactacgacatgtgtgaccgactctacttcgatgaaatctcttttgaggtggtgatg
gacatctatgagctggaaaaccctgaaggtgtgatcttgtccatgggtgggcagctgccc
aacaacatggccatggctttgcatcggcaacagtgtcgggttctgggcacctccccagaa
gccattgactcagctgagaaccgttttaagttctcccggctcctggacaccattggtatc
agccagcctcagtggagggagctcagtgacctagagtctgctcgccagttctgccagacc
gtggggtacccctgtgtcgtgcgcccctcctatgtgctgagtggtgctgctatgaacgtg
gcctacaccgatggggacttggagcgcttcttgagcagtgcagcagctgtctccaaggag
caccccgtggtcatctccaagttcatccaggaggccaaggagattgacgtggatgctgtg
gcttgtgatggtgtggtggcagctatcgccatctccgaacacgtagagaatgcaggtgtg
cattcaggtgatgccacactggtgaccccaccgcaggacatcactgccaaaaccctggag
cggatcaaagccattgtgcatgccgtgggccaggagctgcaggtcacaggacccttcaat
ctgcagctcattgccaaggacgaccagctgaaagtcattgaatgcaacgtgcgtgtgtct
cgctccttccccttcgtctccaagacactaggtgtggacctagtagccttggcgacacgg
gtcatcatgagggaagaagtggagcctgtgggactcatgactggctctggagttgtgggg
gtgaaggtgccccagttctcgttctcccgcctggcgggggctgacgtggtgctgggtgtg
gagatgaccagtactggggaagtagctggctttggggagagccgctgcgaagcctacctc
aaggccatgctcagtactggttttaagatccccaagaagaacatcttgctgaccattggc
agctataagaacaaaagtgagttgctcccaactgtgaggctgctggagagcctgggctac
agcctatacgccagtctgggcaccgctgacttctacacagagcatggtgtcaaggtgacg
gctgtggactggcattttgaagaggcagtggatggagagtccccaccacagcgaagcatt
ttggagcagcttgctgagaaaaactttgaactcgtaattaacctgtccatgcgtggggcc
gggggccggcgtctttcttccttcgtcaccaagggctaccggacacggcgcctggccgct
gacttctccgtacccctcatcattgatatcaagtgcaccaaactgtttgtggaggcgctg
ggacagattgggccagcccctcctctgaaggcgcatgttgactgcatgacctcccagaag
ctcgtgcggctgcctggattgatcgacgtccatgtgcacctgcgggaaccaggggggaca
cacaaggaggactttgcctcgggcacagctgctgccctggccgggggcgtcaccatggtg
tgcgctatgcccaatacccggccccccatcactgatgcccctgccctggccctggcgcag
aagctggcagaggccggcgcccgctgtgactatgccttattcctcggagcctcgtcggaa
aatgcagggaccctgggcactgtggctgggtctgctgcggggctgaagctctacctcaac
gagaccttctctaaactgcggctggacagtgtggcccagtggatggagcacttcgagaca
tggccatcccacctccccatcgtggcccacgccgagcggcagagtgtcgcagccgtcctc
atggtggcccagctggcccagcgctcggtgcacatctgtcatgtggcacggaaggaggag
atcctgctgattaaagcggctaaggcgcgggggctgccggtgacctgtgaggtggcaccc
caccatctgttcctgagccatgatgacctggagcgtctggggcccgggaagggggaggtt
cggcccaaacttggctcccgggaggacgtggaagccctatgggagaacatggccatcatc
gactgttttgcctccgaccacgccccccacaccgtggaggagaagtgtgggccccggcct
ccccccggcttcccagggctggagaccatgctgcccctgctgctgacggcagtgagcgag
ggccggctcagcctggacgacgtgctgcagcgactgcaccacaaccctcggcgcatcttc
cacctgccccctcaggaggacacctatgtggaggtggatctggagcacgaatggacagtc
cccagccacatgcccttctccaaggcccactggacaccctttgaagggcagaaggtgaag
ggcaccatccgccgtgtggtcctgcgtggggaggtggcctatattgacgggcaggtgctg
gtgccacccggctatggacaggacgtccgcaagtggccccagggtgctgttccacagctc
acgccctcggccccggctgccagtgagctaaccacgaccccggagaggccccgccggagc
ggcccagcactccctgatggccgcttccacctgcctccccggatccaccgagcctctgac
ccaggtttgccagctgaggagccaaaggagaagacctcccgcaaggcagctgagccagag
ctgatgggaacccttgatggcatctgctaccctccaccaccagtacctagacaggcgtca
ccccagaacctggggacccctggcctgctgcacccccagacctcacccctgctgcactca
ctagtgggccaacatatcctgtccgtccagcagttcaccaaggatcagatgtctcacctg
ttcaacgtggcacacacgctgcgcatgatggtacagaaggagcggagcctcgacatcctc
aaggggaaggtgatggcctccatgttctacgaggtgagcacacggaccagcagctccttt
gcagcagccatggcccggctcgggggcgctgtgctcagcttctccgaagccacgtcctcc
gtccagaagggcgagtccctggctgactcggtgcagaccatgagctgctacgctgatgtc
gttgtgctgcggcacccccagcccggggcagtggagctggcagccaagcactgccggagg
ccagtgatcaacgcaggggacggggttggagagcaccctacccaggccttgctggacatc
ttcaccatccgggaggagcttgggacggtcaatggcatgacgatcacgatggtgggcgac
ctgaagcatggccgcacggtgcattcgctggcctgcctgctcacccagtaccgtgtcagc
ctgcgctacgtggcgcccccaagcctgcgcatgccccctgacgtgcgggccttcgtggcc
tcccgtggcaccaagcaggaggaatttgagagcatcgaggaggcgctgcctgacaccgat
gtactctacatgacacgcatccagaaggagcgcttcggctccacccaggagtatgaagca
tgcttcggccagttcatcctcactccgcacatcatgacccgggccaagaagaagatggtg
gtgatgcacccaatgccccgtgtcaatgagatcagtgtggaggtggactcagacccccga
gcagcctacttccgccaggcagagaacggcatgtacatccgcatggctctgttggccacc
gtgctgggccgcttctag

DBGET integrated database retrieval system