KEGG   Bos taurus (cow): 504323Help
Entry
504323            CDS       T01008                                 

Gene name
THBS3
Definition
thrombospondin 3
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
bta  Bos taurus (cow)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    504323 (THBS3)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    504323 (THBS3)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    504323 (THBS3)
  Cellular commiunity
   04510 Focal adhesion
    504323 (THBS3)
 Human Diseases
  Infectious diseases
   05144 Malaria
    504323 (THBS3)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   504323 (THBS3)
  Exosomal proteins of colorectal cancer cells
   504323 (THBS3)
  Exosomal proteins of bladder cancer cells
   504323 (THBS3)
Heparan sulfate/heparin binding proteins [BR:bta00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  504323 (THBS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
3
AA seq 956 aa AA seqDB search
METQELRGALALLLLCTFVSASQDLQVIDLLTVGESRQMIAVVEKIRTALLTTGDIYLLS
TFRLPPKQGGVLFGLYSRHDNTRWLEASVVGKINKVLVRYQREDGKVHAVNLQQAGLADG
RTHTALLRLRGPSKPSPALQLYVDCKLGDQHAGLPALAPIPPAEVNGLEIRTGQKAYLRM
QGFVESMKMILGGSMARVGALSECPFQGDESIHSAVTNALHSILGEQTKALVTQLTLFNQ
ILVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRSHCSPNPCFRGVDCMEVYEYPGYRC
GPCPPGLQGNGTHCTDINECTHADPCFPGSSCINTMPGFHCEACPRGYKGTRVSGVGIDY
ARASKQVCNDVDECNDGNNGGCDPNSICTNTVGSFKCGPCRLGFVGNQSQGCFPARTCHS
PAHSPCHAHAHCLFERNGAVSCACNVGWAGNGNVCGPDTDIDGYPDQALPCMDNNKHCKQ
DNCLLTPNSGQEDADNDGVGDQCDDDADGDGIKNVEDNCRLFPNKDQQNSDTDSFGDACD
NCPNVPNNDQKDTDGNGEGDACDNDVDGDGIPNGLDNCPKVPNPLQTDRDEDGVGDACDS
CPEMSNPTQTDADSDLVGDACDTNEDSDGDGHQDTKDNCPQLPNSSQLDSDNDGLGDECD
GDDDNDGVPDYVPPGPDNCRLVPNPNQKDSDGDGVGDVCEDDFDNDAVVDPLDVCPESAE
VTLTYFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGT
FHVNTVTDDDYAGFLFSYQDSGRFYVVMWKQTEQTYWQATPFRAVAQPGLQLKAVTSVSG
PGEHLRNALWHTGNTPDQVRLLWTDPRNVGWRDKTSYRWQLLHRPQVGYIRVKLYEGPQL
VADSGVIIDTSMRGGRLGVFCFSQENIIWSNLQYRCNDTVPEDFEPFRRQLLQGRV
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atggagacacaggaacttcggggggccctggctcttctcctcctttgcactttcgtatct
gccagtcaggacctgcaggtgatcgacctgctgacagtgggcgagtcccggcagatgata
gctgtggtggagaagatccggacagccctgctcaccactggggacatctatctcttgtcc
accttccgcctgccccccaagcagggtggtgtcctctttggcctctactctcgccacgac
aacacacgatggctggaggcctctgtcgtcggcaagatcaacaaagtgctggtgcggtac
cagcgggaggatggcaaggtgcatgcagtgaacctccagcaagcaggcctggctgacggg
cgcacacacacggctctcctgcgactccgaggtccatccaaacccagccctgccctgcag
ctctatgtggactgcaaactgggcgaccagcatgctggacttccggcactggcccccatt
cctccagcagaggtcaatgggctggagattaggactggacagaaggcttatttgaggatg
cagggctttgtggaatccatgaagatgattctgggcgggtccatggcccgggttggagcc
ctgagtgagtgtccattccagggagacgagtccatccacagtgcagtgaccaacgcactc
cactccatcctaggggagcagaccaaggccttggtcacccagctcaccctcttcaaccag
atcctggtggaactgcgggatgacatccgagaccaggtgaaagaaatgtccctgatccga
aacaccatcatggagtgtcaggtgtgcggcttccatgaacagcgttcccactgcagcccc
aacccctgcttccgaggcgtggactgcatggaagtgtacgagtaccccggctaccgctgt
gggccctgccctcctggcctgcagggcaatggcacccactgcacagacatcaatgagtgt
actcacgcggacccttgcttcccgggctccagctgcatcaacaccatgcctggcttccac
tgtgaggcctgtccccgaggctacaaaggcacacgggtgtctggtgtgggcattgactac
gcccgggccagcaaacaggtctgcaacgatgttgatgaatgcaatgatggtaacaatggt
ggctgtgacccaaactccatctgcaccaatactgtgggctcgttcaagtgtggtccatgt
cgcttgggctttgtgggtaaccagagccagggctgcttcccggcccggacctgccacagc
ccggcccacagcccttgccacgcccacgctcactgtctctttgaacgcaacggtgcagtg
tcctgtgcgtgtaacgtgggctgggccgggaatgggaacgtgtgtgggcccgacacggac
atcgatggctacccggaccaggcactgccctgcatggacaacaacaaacactgcaagcag
gacaactgccttctgacacccaactctgggcaggaagatgctgataacgacggcgtgggg
gaccagtgcgacgatgatgccgacggggatggcatcaagaacgttgaggacaactgccgg
ctgttccccaacaaggaccagcaaaactcagatacagattcgtttggtgatgcctgtgac
aactgccccaacgtccccaacaatgaccagaaagacacagacggcaacggggaaggggat
gcctgtgacaacgacgtagatggcgacggcatccccaatggactggacaactgccctaaa
gtccccaacccgctgcagacagacagggatgaggacggggtgggagatgcttgcgacagc
tgccctgaaatgagcaatcccacccagacagatgcagacagtgacctagtgggagatgcc
tgtgacaccaatgaagacagtgatggggatggacatcaggacaccaaggacaactgtcca
cagctgcccaacagctcccagctggactcagataacgacggacttggagatgagtgtgat
ggggacgatgacaatgacggggttccagattacgtgcctcctggtcctgataactgtcgc
ctcgtacccaatcccaatcagaaggactcagatggcgatggcgttggtgatgtgtgtgag
gatgactttgacaatgatgcagtggtcgaccccctggatgtgtgtcctgaaagtgcagag
gtaaccctcacatattttcgtgcctatcagaccgtggtcctggatcctgaaggtgatgct
cagattgaccccaactgggtcgtgctcaaccagggcatggaaattgttcagaccatgaac
agtgaccccggcctggcagttggatatacagccttcaacggtgtggactttgaaggcacc
ttccatgtgaacactgtgacggacgatgactacgcaggctttctcttcagttatcaggac
agcggccgcttctacgtggtcatgtggaagcagacagagcagacctactggcaggccacg
cctttccgggctgttgcccagccagggctacagctcaaggcagtgacatcagtgtctggc
ccaggtgagcacctcaggaacgccttgtggcatacaggcaatactcctgatcaggtacga
ctgctgtggactgatccacgaaatgtgggctggcgtgacaagacctcctaccgctggcag
ctgctgcaccggcctcaagtgggctatattcgggtgaagctttatgagggtccccagcta
gtggccgattctggggtgatcattgacacatccatgcgaggggggcgtcttggtgtattc
tgcttctcccaagaaaacatcatttggtccaatctccagtatcgatgcaatgacacagtg
cccgaggactttgagccattccggaggcagctgcttcagggaagagtgtga

DBGET integrated database retrieval system