KEGG   Bos taurus (cow): 504437Help
Entry
504437            CDS       T01008                                 

Gene name
AURKA, ARK-1
Definition
(RefSeq) aurora kinase A
  KO
K11481  aurora kinase A [EC:2.7.11.1]
Organism
bta  Bos taurus (cow)
Pathway
bta04114  Oocyte meiosis
bta04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:bta00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    504437 (AURKA)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    504437 (AURKA)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     504437 (AURKA)
Protein kinases [BR:bta01001]
 Serine/threonine kinases: AGC group
  AUR family [OT]
   504437 (AURKA)
Protein phosphatases and associated proteins [BR:bta01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     504437 (AURKA)
Chromosome [BR:bta03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    504437 (AURKA)
   Spindle formation proteins
    504437 (AURKA)
  Sister chromatid separation proteins
   Aurora kinases
    504437 (AURKA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like MTBP_C FTA2 APH Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 504437
NCBI-ProteinID: NP_001033117
BGD-bta: BT20859
Ensembl: ENSBTAG00000013009
UniProt: Q2TA06
Position
13
AA seq 402 aa AA seqDB search
MDRCKENCISGPKTAVPLSDGPKRVPVAQQFPSQNPVSVNSGQAQRVLCPTNSSQRVPSQ
AQKLVSIQKPVQTLKQKPPQAASAPRPVTRPPSNTQKSKQPQPPAPGNNPEKEVASKQKN
EESKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRR
EVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGAVYRELQKLSKFDEQRTATYITEL
ANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEM
IEGRMHDEKVDLWSLGVLCYEFLVGKPPFEADTYQETYRRISRVEFTFPDCVPEGARDLI
SRLLKHNPSQRPTLKEVLEHPWIIANSKPSSCQKKESTSKQS
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggacagatgtaaagaaaactgcatctcagggcctaagactgcagttccacttagtgat
ggcccaaaacgtgttccagtagctcagcagtttccctctcagaatccggtgtctgtaaac
agcggccaggctcagcgtgtcctgtgtcccacaaattcctcgcagcgtgttccttcacaa
gcacagaagctagtctccatccagaaaccagtacagaccctgaagcagaagccaccacag
gcagccagtgcccctcgtcctgtcaccaggccgccaagtaacacccagaagagcaaacaa
ccccagccaccagcgcctggaaataatcctgagaaggaagtggcatcaaaacaaaaaaat
gaagaatcaaaaaaaaggcaatgggctttggaagattttgaaattggtcgcccgctgggt
aaaggaaagtttggtaatgtttatttggcgagagaaaaacaaagcaagtttattctggct
cttaaagtattattcaaagctcagctggagaaggcaggcgttgagcatcagctgagaaga
gaagtagaaatacagtcacatctcaggcatccaaacatcctcagactgtatggttatttc
cacgacgctaccagagtctacttaattttggaatatgcacccctcggagctgtctataga
gaacttcagaaactgtcaaagtttgatgagcagagaactgccacatatatcacagaattg
gcaaatgccttgtcttactgtcattcaaagagagttattcacagagacattaagccagag
aacctgctccttggatcagctggagagcttaagatcgccgattttgggtggtcagtacat
gccccatcctccaggaggaccaccctctgcggcacgctggactacctgccccctgagatg
attgagggccggatgcacgacgagaaagtggacctctggagccttggggtgctttgctat
gagttcctcgttgggaagcctccttttgaggcagacacataccaggagacctacagaaga
atatcacgggtggaattcacattccctgactgcgtgcccgagggagccagggacctcatt
tcaagactgttgaagcacaaccccagccagaggcctaccctcaaagaagtacttgaacac
ccctggatcatagccaactcaaaaccatcaagttgtcagaaaaaagaatcaactagcaaa
cagtcttaa

DBGET integrated database retrieval system