KEGG   Bos taurus (cow): 504581Help
Entry
504581            CDS       T01008                                 

Gene name
USP36
Definition
ubiquitin specific peptidase 36
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     504581 (USP36)
Peptidases [BR:bta01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   504581 (USP36)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
19
AA seq 1101 aa AA seqDB search
MPIVDKLKEALKPGRRDSADDGDLGKLLAASAKKVLLQKLEFEPASKSFSYQLESLKSKY
VLLNPRTEGARCHRSGDEPPARRQGSEHAYESCSDGVPAPQKVLFPVERLSLRWGRVYRV
GAGLHNLGNTCFLNSTVQCLTYTPPLANYLLSKEHTRGCHQGSFCMLCVMQNHIIQAFAN
SGNAIKPVSFIRDLRKIARHFRFGNQEDAHEFLRYTIDAMQKACLSGCAKLDRQTQATTL
VHQIFGGYLRSRVKCSMCKSVSDTYDPYLDVALEIRQAANIVRALELFVKPDVLSGENAY
MCAKCKKKVPASKRFTIHRTSNVLTLSLKRFANFSGGKITKDVGYPEFLNIRPYMSQSSG
EPVMYGLYAVLVHSGYSCHAGHYYCYVKASNGQWYQMNDSLVHASNIKVVLNQQAYVLFY
LRIPGSKKSPEGSISRTASLSSRPGVVPDHVRKNVSNGTAASPMTGKRPDPVTMKKPQTP
EELGVPIARNGSVLGLKSPNGYAPAKPPLASPSPKVCRTPTHAPAILDEPGKKVKKPASL
QHFSPPPSASAPGGSRSEGRRPGSWDGRAAVSTSLRAPAAGTPNGLGPQAGDEGPTPERG
GSSPEHPTSRPPQAPQSGVTPLGDSQGTHSVTAGPTKVLPARQDAEPEKAKCPVPSSTSP
EPANTMSPPPAKKLALSAKKASTLRRATGNDLRPPALSPSSDLTYPRKPTHPIVAAPWPV
RAIRAVSPAPRPSSHLKPPFGPCPPSLSSSPHPLGTSDPQSCSPTSAPLPQVNGAFRAPL
HQLPEASEPLRSLGKKRKKTRVKVGGRVSETCTAVAAQPGKRRKRKRKHMGDVDATPLQD
ERTPGPPWSPERRKEGRAEPPADRSEEEGRQQPGSGQRLENSWPVGCMTNGPHVSSRKRR
RKGLESCDEEDCLPGDPPWHGSCVPSDVVQPETVATSPRKKKKKKKKQEPRQEVEEKEPE
GQRGPAVPGCSPLPAVNGQAPRGPTGLGPAPLASWDRERESDVVQELLKYSSDKAYGRKV
LTWDGAVSAVSQDAIQDSRLARTATVIDDWDEEFDRGKEKKLKKFKREKKRNFNAFQKLQ
SRRNFWSVTHPAKASSLSYRR
NT seq 3306 nt NT seq  +upstreamnt  +downstreamnt
atgcccattgtggacaagctgaaggaagccctcaagcctggccgcagggattcggctgac
gatggggatctggggaagcttttggccgcctctgccaagaaggtccttctgcagaagctg
gagtttgagccggccagcaagagtttctcctaccagctggagtcactgaaaagcaaatat
gtgctgctgaaccccaggacagagggagccaggtgccaccggagcggagatgaaccaccg
gcccggagacagggcagcgagcacgcctacgagagctgcagcgacggggtccccgcgccc
cagaaggtgctcttcccggtggagcggctgtcactgcgctgggggcgtgtgtaccgcgtg
ggcgctggcctgcacaacctcggcaacacctgcttcctcaactccaccgtgcagtgcttg
acctacacgccgcccctggccaactacctgctctccaaggagcacacgcggggctgtcac
cagggcagcttctgcatgctgtgcgtcatgcagaaccacatcatccaggccttcgccaac
agtggcaacgccatcaagcccgtgtccttcatccgggacctgcgaaagatcgcccggcac
ttccgctttgggaaccaggaagatgcacatgagtttctgcggtataccatcgacgccatg
cagaaggcctgcctgagcggctgtgccaagttggatcgtcagacgcaggctacaaccctg
gtccatcagatttttggaggctacctccgatctcgggtgaagtgctccatgtgcaagagc
gtctcagacacctacgacccctacttggatgtggcgctggaaatccggcaagctgcaaac
atcgtgcgtgctctggaactttttgtgaaaccagatgtcctgagcggagagaatgcctat
atgtgtgcaaaatgcaaaaagaaggttccagccagcaagcggttcaccatccaccggaca
tccaacgtcctgacgctctcgctcaagcgctttgccaacttcagtggggggaagatcacc
aaggatgtgggctacccagagttcctgaacatccgcccgtacatgtcccagagcagtggc
gagcctgtcatgtacgggctgtatgctgtcctcgtccactcgggctacagctgccatgcc
gggcactattactgctatgtgaaggcaagcaatggacagtggtaccagatgaacgactcc
ttggtccacgccagcaacatcaaggtggttctgaaccagcaggcctacgtcctcttctac
ctgcggattccaggctctaagaagagtcccgagggctccatctccaggactgcctccctt
tccagccgccccggcgtggttccggaccatgtccggaagaatgtcagcaacggaaccgcg
gcctctccaatgaccggaaagagaccagaccctgtgacgatgaagaagccacagaccccc
gaagaacttggagtacccattgccaggaacggctctgtgttgggcctgaagtctccgaat
ggatatgctcctgccaagccccccctggcgtccccttcccccaaagtctgcagaacaccc
acccacgcgccagccattctggatgagcctggaaagaaagtcaagaagccagcgtccctg
cagcacttctcccctccacccagtgccagcgcaccgggaggcagcaggagcgagggtcgc
aggccaggctcctgggacggccgggccgctgtctctacctcactccgggccccagctgcg
gggacgcccaatgggcttgggccccaggcgggcgacgagggccccacccctgagaggggg
ggctccagccctgagcaccccaccagcaggcccccgcaagccccccagagcggagtcact
cccctcggagattctcagggaacccactccgtcactgccggcccgaccaaggtgctgccg
gcccgacaggatgccgagccggagaaggccaagtgccccgtcccgagcagcaccagccct
gagccggccaacaccatgtctcctcctccggccaaaaagctggccctctctgccaagaag
gccagcaccctgcggagggcaaccggcaatgacctccgtccacctgccctctctccatcc
tccgacctcacctacccccggaaacccactcaccccatcgtcgccgccccctggcctgtc
cgtgcaatacgggctgtctcgcctgctcccagaccctccagccatctgaagccccccttc
ggcccctgtcccccatcactgtccagcagcccccatcctcttgggacatcagacccacag
agctgctcgcccacctctgcacccctgcctcaggtcaatggggccttccgggccccgcta
caccagctgccagaggccagtgagcccctccggagccttggtaaaaagaggaagaagact
cgcgtgaaagtggggggccgtgtctcggagacctgcacggccgtggcggcccagcccggg
aagaggaggaagaggaagaggaagcacatgggggacgtggacgccacccccctgcaggac
gagcggacaccagggccgccctggagccctgaacgcaggaaggagggccgggcggagcca
ccggcagacagatcggaggaagaaggcagacagcagccagggagtggccagcgcctggag
aacagctggccagtgggatgcatgaccaatggcccccatgtgagcagcaggaagaggagg
agaaagggactggagagctgtgacgaagaagactgcctccccggggacccaccttggcat
gggagctgcgtgccctcggacgtcgtccagccagagactgttgcaacatcaccgaggaaa
aagaaaaagaaaaaaaagaagcaagagccacgacaagaagtagaagagaaggagcccgag
ggccagaggggccccgctgtccctgggtgcagccccctgccagctgtgaatggccaggct
cccaggggccccacagggctgggaccggctccacttgcatcctgggacagagagagagaa
tccgatgtggtccaagaattgctcaaatactcatctgataaagcttatgggagaaaagtt
ttgacgtgggacggcgcggtgtcggccgtcagtcaggacgccattcaggacagcaggctg
gcccgcacggccacggtcattgacgactgggacgaagagttcgaccgagggaaggagaag
aaattgaaaaaattcaagagagagaagaaaagaaacttcaacgccttccaaaaacttcag
agtagacggaatttttggtctgtgactcacccagctaaggcttccagtctgagctatcgc
cgctga

DBGET integrated database retrieval system