KEGG   Bos taurus (cow): 504769Help
Entry
504769            CDS       T01008                                 

Gene name
CYP2B6, CYP2B
Definition
cytochrome P450 subfamily 2B
Orthology
K07412  
cytochrome P450, family 2, subfamily B [EC:1.14.14.1]
Organism
bta  Bos taurus (cow)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Retinol metabolism
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    504769 (CYP2B6)
   00590 Arachidonic acid metabolism
    504769 (CYP2B6)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    504769 (CYP2B6)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    504769 (CYP2B6)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     504769 (CYP2B6)
Cytochrome P450 [BR:bta00199]
 Cytochrome P450, animal type
  CYP2 family
   504769 (CYP2B6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
18
AA seq 442 aa AA seqDB search
MELSMLLLFALLTGLLVLLARGRPKAHGRLPPGPRPLPFLGNLLQMDRKGLLKSFLRGYG
VIFANGERWKALRRFSLATMRDFGMGKRSVEERIQDEAQCLVEELRKSQGALQDPVFYFH
SITANIICSIVFGKRFDYRDPEFLRLLELLFQSFVLISSLSSQLFELYSSFLKYFPGSHR
QIYKNLQEINVFIGRSVEQHRETLDPNAPRDFIDCYLLRMEKDKSNPQSQFDHQNLIMSV
LSLFFAGTETTSTTLRYGFLLMLKYPHITERIQKEIDQVIGSYRPPALDDRAQMPYTDAV
IHEIQRFADLIPIGVPHMVTKDTHFRGYILPKGTEVYPVLSSALHESCYFEKPDDFNPDH
FLDANGVVKKNDAFMPFSIGKRICLGEGIARIELFLFFTTILQNFSVASPVAPEDIDLTP
QESGVGNVPPNYRIQFLPRQRG
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggagctcagcatgctccttctctttgctctgctcactggactcttggtcctcctggcc
agaggccgcccaaaggcccatggccgcctcccgcctggcccccgtcctctgcccttcctg
gggaaccttctgcagatggacagaaaaggcctgctcaaatccttcctgaggggatatggt
gttatctttgccaatggggaacgttggaaggcccttcggcgattctctctggccaccatg
agggacttcgggatgggaaagcggagcgtggaggagcggattcaggacgaggctcagtgt
ctggtggaggagcttcggaaatcccagggagccctccaggatcccgtcttctacttccac
tccatcaccgccaacatcatctgctccattgtctttggaaaacgctttgactacagagat
cctgagttcctgaggctgctggagttgttattccaatctttcgtgctcatcagctccctg
tccagccagctgttcgagctctactccagcttcttgaagtactttcctggctcacacagg
caaatctacaaaaacctgcaggaaatcaacgtcttcattggccgcagtgtggagcagcac
cgtgagaccctcgaccccaacgccccccgggatttcattgactgctacctgctccgcatg
gaaaaagataagtccaacccccaaagccagttcgatcatcagaacctcatcatgtctgtt
ctgtctctcttctttgctggcacggagacaaccagcaccacgctccgctatgggttcctg
ctcatgctcaaatacccccacatcacagagagaatccaaaaggagattgaccaggtgatt
ggctcatatcgccctccagccctggatgacagagcccaaatgccatacacagacgcagtc
atccatgagattcagagatttgcggacctcatccccattggtgtgccccacatggtcact
aaagatactcatttccgagggtacatccttcccaagggcacagaagtctatcccgtcctg
agctctgctcttcatgaatcgtgttactttgagaaaccagatgacttcaaccctgaccac
tttctggatgccaacggggtagtgaagaaaaatgatgcttttatgcccttctccataggg
aagcgtatctgtcttggtgaaggcattgcccgcatcgaattattcctcttcttcaccacc
atcctccagaacttctccgtggccagccccgtggcccctgaggacatcgaccttactccc
caggagagtggagtgggcaacgtgcccccaaactatcggatccagttcctgccccgtcaa
agaggctga

DBGET integrated database retrieval system