KEGG   Bos taurus (cow): 505005Help
Entry
505005            CDS       T01008                                 

Gene name
BCKDK
Definition
branched chain ketoacid dehydrogenase kinase (EC:2.7.11.4)
Orthology
K00905  
[3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase [EC:2.7.11.4]
Organism
bta  Bos taurus (cow)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
25
AA seq 412 aa AA seqDB search
MILASVLGSGPRGGPPLRPLLGPALSLRARSTSATDTHHVEMARERSKTVTSFYNQSAID
VAAEKPSVRLTPTMMLYSGRSQDGSHLLKSARYLQQELPVRIAHRIKGFRSLPFIIGCNP
TILHVHELYIRAFQKLTDFPPIKDQADEARYCQLVRQLLDDHKDVVTLLAEGLRESRKYI
EDEKLVRYFLDKTLTSRLGIRMLATHHLALHEDKPDFVGIICTRLSPKKIIEKWVDFARR
LCEHKYGNAPRVRINGHVAARFPFIPMPLDYILPELLKNAMRATMESHLDTPYNVPDVVI
TIANNDIDLVIRISDRGGGIAHKDLDRVMDYHFTTAEASTQDPRISPLFGHLDLHSGGQS
GPMHGFGFGLPTSRAYAEYLGGSLRLQSLQGIGTDVYLRLRHIDGREESFRI
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgatactggcttcggtgctggggagcggaccccggggcgggccacccctccggcctctc
ttggggcccgcactctcgctccgggcccgctccacatcagccactgatacccaccatgtg
gaaatggcacgggagcgctctaagaccgtcacctccttttacaaccagtcagccattgac
gtcgcagcggagaagccttcagtccgcctcactccaaccatgatgctctattcaggccgc
tcccaggatggcagtcacctcctgaaaagtgcccgctacttgcagcaggagttgccagtg
aggatcgctcaccgcatcaagggcttccgcagccttcctttcatcattggctgcaacccc
accatactgcacgtgcacgagctgtacatccgtgccttccagaagctgacagacttccct
ccgatcaaggaccaggcggatgaggcccgatactgccagctggtgcgacagctgttggat
gaccacaaggacgtggtgaccctcttagcggaaggcctgcgtgagagccggaagtacata
gaggatgagaagctcgtccgttacttcttagacaagacgttgacttcaaggcttgggatc
cgtatgttggccacccaccatctggcactacatgaggacaagcccgactttgttggcatc
atctgcactcgcctgtcaccgaagaagattattgaaaagtgggtggactttgccagacgc
ctgtgtgagcacaagtatggcaatgcaccccgagtccgcatcaacggacacgtggctgcc
cgtttccccttcatcccaatgccactggactacatcctacctgagctgctcaagaacgcc
atgagagccacaatggagagtcacctcgacactccctacaatgtcccagatgtcgtcatc
accatcgccaacaatgatatcgatctcgtcatcaggatttcagaccggggcgggggaatt
gctcacaaagacctggatcgggtgatggactaccacttcactacagctgaggccagcacc
caggacccccggatcagccccctctttggccacctggacttgcacagtggtggccagtca
ggacccatgcacggctttggcttcgggctgcccacttcgcgggcctacgcagagtacctc
ggtggttcccttcggctgcagtcgctgcagggcattggcacagatgtctacctacggctc
cgtcacatcgatggccgggaagaaagcttccgcatctga

DBGET integrated database retrieval system