KEGG   Bos taurus (cow): 505012Help
Entry
505012            CDS       T01008                                 

Gene name
G6PC2
Definition
glucose-6-phosphatase, catalytic, 2 (EC:3.1.3.9)
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
bta  Bos taurus (cow)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    505012 (G6PC2)
   00052 Galactose metabolism
    505012 (G6PC2)
   00500 Starch and sucrose metabolism
    505012 (G6PC2)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    505012 (G6PC2)
   04151 PI3K-Akt signaling pathway
    505012 (G6PC2)
   04152 AMPK signaling pathway
    505012 (G6PC2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    505012 (G6PC2)
   04920 Adipocytokine signaling pathway
    505012 (G6PC2)
  Digestive system
   04973 Carbohydrate digestion and absorption
    505012 (G6PC2)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     505012 (G6PC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
2
AA seq 355 aa AA seqDB search
MDFLHRNGVLVIQHLQKDYRAYYNFLNFMSNVGDPRNIFSIYFPLWFQLNQTVGTKMIWV
AVIGDWFNLIFKWILFGHRPYWWVQETQIYPNHSSPCLEQFPTTCETGPGSPSGHAMGSS
CVWYVMVTAALSHTVSQMDKSFITLHRLTWSFLWSLFWLIQINVCISRVFIATHFPHQVI
LGVIGGVLVAEIFEYTPGIQTASLSVYLKTNLFLFLFALGFYLLLRHLDIDLLWSVPIAK
KWCANPDWIHIDTTPFAGLVRNLGVLFGLGFAINSEMFLRSCRGENGYGLSFRLLCALVS
LTTLQLYHFIKIPTDTEYLFYVLSFCKSASIPLTVVALIPYCIHMLMKPSAKKLN
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggatttccttcataggaatggagtgctcgttattcagcatttgcagaaggactaccga
gcttactacaattttctaaattttatgtctaatgttggagatccccggaatatcttttct
atttattttccactttggtttcaacttaatcagacagttggaactaagatgatatgggta
gcagtcattggggattggttcaatcttatttttaaatggatattatttggtcatcggcct
tactggtgggtccaagaaactcagatttacccaaatcactcaagtccatgccttgaacag
ttccccactacatgcgaaacaggtccaggaagtccatctggccatgcgatgggttcatca
tgtgtctggtatgtcatggtgacagcggccctgagccacaccgtcagtcagatggataag
tcttttatcactctgcacagactgacttggtcatttctttggagtctcttttggttgatt
caaatcaatgtctgcatctccagagtattcatagcaacacattttcctcatcaagttatt
cttggagtaattggtggcgtcctggtagcggagatctttgaatacactccaggtatccaa
acagccagcctgagtgtatacctgaagaccaacctgttcctcttcctgtttgcacttggc
ttttacctgctgctcagacatcttgacattgacctgctgtggtccgtgcccatagccaag
aagtggtgcgccaaccccgactggatccacattgacaccacaccttttgccggacttgtg
agaaacctcggggtcctctttggcctgggctttgcaattaactcagagatgttcctcagg
agctgtcgaggagaaaacggctacgggctgagcttccggctgctctgtgccctggtctcg
ctgaccactctgcagctctaccacttcatcaagatccccactgacaccgagtatttgttt
tacgtgctgtctttctgtaaaagtgcgtccatcccactgactgtggttgccctgattccc
tactgtattcatatgttaatgaaaccaagtgccaaaaagcttaattag

DBGET integrated database retrieval system