KEGG   Bos taurus (cow): 505106Help
Entry
505106            CDS       T01008                                 

Gene name
USP14
Definition
ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase) (EC:3.4.19.12)
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     505106 (USP14)
Peptidases [BR:bta01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   505106 (USP14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
24
AA seq 494 aa AA seqDB search
MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGN
IKMKNGMTVLMMGSADALPEEPSAKTVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATV
QCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLH
MAFPQFAEKGEQGQYLQQDANECWVQMMRVLQQKLEAIEDDTVKETDSSSASAVTPSKKK
SLIDQFFGVEFETTMKCTESEEEEVTKGKESQLQLSCFINQEVKYLFTGLKLRLQEEITK
QSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDVYELCT
PELQEKMVSFRSKFKDLEDKKVNQQPKTGDKDSSPQKEVKYEPFSFADDIGSNNCGYYDL
QAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLY
GPRRVEIMEEESEQ
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgccgctctactccgttactgtgaaatggggaaaggagaaatttgaaggtgtagaattg
aatactgatgaacctccgatggtgttcaaggctcagctttttgcactgactggagtccag
ccggccagacagaaagttatggtgaaaggaggaacactgaaggatgatgattgggggaac
atcaaaatgaaaaatggaatgactgtactaatgatggggtcagcagacgctcttcctgag
gaaccctcagctaaaactgtctttgtagaagacatgacagaagaacagttagcatctgct
atggagttaccatgtggattgacaaacctgggtaatacttgttacatgaatgccacagtt
cagtgtattcgttctgtgcctgaactcaaagatgcccttaaaaggtatgcaggcgccttg
agagcttcaggagagatggcgtccgcacagtacattactgcagcccttagagatttgttt
gactccatggataaaacttcttctagtattccaccaattattctactgcaatttttgcac
atggcttttccacagtttgcagagaagggcgaacaaggacagtatcttcagcaggatgct
aatgagtgttgggtacaaatgatgcgagtattacagcagaaattggaagctatagaggat
gatactgttaaagagacagattcttcatctgcatcagcagtgacaccttctaaaaagaaa
agtttaattgatcagttctttggagttgaatttgagacgaccatgaaatgtacagaatct
gaagaagaagaagtcactaaaggaaaggaaagtcagcttcagcttagctgtttcatcaat
caagaagtcaagtatctttttacaggacttaagttgcgacttcaggaagaaatcaccaaa
cagtctccaacattgcaaagaaatgctttgtacatcaaatcttcaaagatcagccggtta
cctgcttacttaactattcagatggttcgatttttttacaaagagaaggaatctgtgaat
gctaaagttcttaaggatgtgaaatttcctcttatgttggatgtgtatgaactatgtaca
ccagaacttcaagagaaaatggtttcttttcgatcaaaattcaaggatctagaggataaa
aaagtaaatcagcagccaaagacaggtgacaaagacagtagtccccaaaaagaagttaag
tatgagcccttttcttttgctgatgacattggctccaataattgcggatactatgattta
caagcagtgctaacgcatcagggaaggtctagctcttcaggccattatgtatcatgggtg
aaaaggaaacaagatgaatggatcaagtttgatgacgataaggtcagcattgtaacacca
gaggatatcttacgactttccggtggtggagactggcacatagcttatgttctactctac
gggcctcgcagagtggaaataatggaagaggaaagtgaacagtaa

DBGET integrated database retrieval system