KEGG   Bos taurus (cow): 505149Help
Entry
505149            CDS       T01008                                 

Gene name
DYRK3
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3 (EC:2.7.12.1)
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
bta  Bos taurus (cow)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
16
AA seq 587 aa AA seqDB search
MGGTARGPGRKDEGPPGAALPPQQRRLGDGVYDTFMMIDETKCPPCSNVPCNPSEPPLPR
RLNITTEHLTRDPTQRFLNGGEMKVEQLFQDFSNRRADNLQSDGVNDSEKCSPTASQGKS
SDSLNTVKSSSSSKASKAVPLTPEQALKQYKHHLTAYEKLEIVNYPEIYFVGPNAKKRHG
VIGGPNNGGYDDADGSYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMV
RNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIK
KNKFQGFSIQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKQHGRSATKVIDFGSSC
FEYQKLYTYIQSRFYRAPEIILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLAC
MMELLGMPPAKLLEQSKRAKYFINSKGLPRYCSVTTQADGRAVLVGGRSRRGKKRGPPGS
KDWVMALKGCEDYLFIEFLKRCLHWDPSARLTPAQALRHPWISKSVPRPLTIEKVSGKRV
VNPANAFQGLGSKLPPVVGIANKLKANLMSETSGGMPLCSVLPKLIN
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgggaggcacggctcgcgggcccgggcggaaggatgaggggccgccgggggccgcactc
ccgccgcagcagcggagattgggggatggtgtctatgataccttcatgatgatagatgaa
accaaatgcccaccctgttcaaatgtaccctgcaatccttctgaaccacctctacccaga
agactaaatatcaccactgagcatttaacaagagatcctactcaacgcttcctgaatgga
ggcgagatgaaggtagaacagctatttcaagacttcagcaacagaagagctgacaacctt
cagtcggatggtgtcaacgactctgaaaaatgctctcccaccgcttctcagggtaaaagt
tcggatagtttgaatacagtgaaatccagcagctcatccaaagcatccaaagcggtgcct
ctgactccagaacaggccctgaagcaatataagcatcacctcactgcttatgagaagctg
gaaattgtcaattatccagaaatttactttgtgggtccaaatgccaaaaaaagacatgga
gttattggtggtcctaataacggcgggtatgacgatgcagatgggtcctatattcacgtg
cctcgagaccatctagcttatcgatatgaggtgctgaaaattattggcaagggcagtttt
gggcaggtagcccgggtctatgatcacaaacttcgacagtacgtggccctgaagatggtg
cgcaatgaaaagcgcttccatcgccaagcggcagaggagatccggattttggagcatctt
aaaaagcaggataaaaccggtagcatgaacgtgattcacatgctagaaagtttcacattc
cggaaccatgtttgcatggcctttgaattgctgagcatagacctttatgagctcattaaa
aaaaacaagttccagggctttagcatccagttagttcgcaagttcgctcaatccatcttg
caatccttggatgcgctccacaaaaacaagatcattcactgtgacctaaagccagaaaac
attctcctgaaacagcatgggcgcagcgcaaccaaggtcattgactttggctccagctgt
ttcgagtaccagaagctgtacacttacatccagtctcggttttacagagctccggagatc
atcctgggaagccgctacagcacacccatcgacatatggagttttggctgcatccttgca
gaacttttaacaggacagccgctcttccctggagaggatgaaggagaccagctggcctgt
atgatggaacttctggggatgccaccagcaaaacttctggaacaatccaaacgtgccaag
tactttattaactccaagggcctgcctcgctactgttctgtgaccacgcaggccgatggg
agggctgtgcttgtgggaggtcgttcgcggaggggtaagaagcggggtcccccaggcagc
aaagattgggtgatggcactgaaagggtgtgaggactacttatttatagagtttctgaaa
agatgcctccactgggacccctctgcccgcttgaccccggctcaagcattaagacaccct
tggattagcaaatctgttcctagacctctcaccattgaaaaggtgtcaggcaaacgggta
gtaaatcctgcaaatgctttccagggcctgggttccaagttgcctccagttgtaggaata
gccaataagctcaaagctaatttaatgtcagagacgagtggtggtatgcctctgtgcagt
gtattgccaaagctgattaactga

DBGET integrated database retrieval system