KEGG   Bos taurus (cow): 505453Help
Entry
505453            CDS       T01008                                 

Gene name
CREBBP, hmm291030
Definition
CREB binding protein (EC:2.3.1.48)
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
bta  Bos taurus (cow)
Pathway
cAMP signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Long-term potentiation
Melanogenesis
Thyroid hormone signaling pathway
Huntington's disease
Tuberculosis
Hepatitis B
Influenza A
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
MicroRNAs in cancer
Renal cell carcinoma
Prostate cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    505453 (CREBBP)
   04330 Notch signaling pathway
    505453 (CREBBP)
   04350 TGF-beta signaling pathway
    505453 (CREBBP)
   04630 Jak-STAT signaling pathway
    505453 (CREBBP)
   04066 HIF-1 signaling pathway
    505453 (CREBBP)
   04068 FoxO signaling pathway
    505453 (CREBBP)
   04024 cAMP signaling pathway
    505453 (CREBBP)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    505453 (CREBBP)
  Cellular commiunity
   04520 Adherens junction
    505453 (CREBBP)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    505453 (CREBBP)
   04916 Melanogenesis
    505453 (CREBBP)
  Nervous system
   04720 Long-term potentiation
    505453 (CREBBP)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    505453 (CREBBP)
   05206 MicroRNAs in cancer
    505453 (CREBBP)
   05203 Viral carcinogenesis
    505453 (CREBBP)
   05211 Renal cell carcinoma
    505453 (CREBBP)
   05215 Prostate cancer
    505453 (CREBBP)
  Neurodegenerative diseases
   05016 Huntington's disease
    505453 (CREBBP)
  Infectious diseases
   05152 Tuberculosis
    505453 (CREBBP)
   05166 HTLV-I infection
    505453 (CREBBP)
   05164 Influenza A
    505453 (CREBBP)
   05161 Hepatitis B
    505453 (CREBBP)
   05168 Herpes simplex infection
    505453 (CREBBP)
   05169 Epstein-Barr virus infection
    505453 (CREBBP)
Enzymes [BR:bta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     505453 (CREBBP)
Transcription factors [BR:bta03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    505453 (CREBBP)
Mitochondrial biogenesis [BR:bta03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    505453 (CREBBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
25
AA seq 2435 aa AA seqDB search
MAENLLDGPPNPKRAKLSSPGFSANDSTDFGSLFDLENDLPDELIPNGGELSLLNSGNLV
PDAASKHKQLSELLRGGSSSSINPGIGNVSASSPAQQGLGSQAQGQPSSANMASLGAMGK
SPLNQGDSSAPSLPKQAASTSGPTPPASQALNPQAQKQVGLVTSSPATSQTGPGICMNAN
FNQTHPGLLNSNSGHGLMNQAQQGQAQVMNGSLGAAGRGRGAGMPYPTPAMQGATSSVLA
ETLTQVSPQMASHAGLNTAQAGGMSKMGMTGNTSPFGQPFSQTGGQQMGAPGVNPQLPSK
QSMVNSLPPFAADIKNASVTNVPNMPQMQTSVGIVPTQAIATGPTADPEKRKLIQQQLVL
LLHAHKCQRREQANGEVRACALPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWK
NCTRHDCPVCLPLKNASDKRNQQTILGSPAGGIQNTIGSVGTGQQNATSLSNPNPIDPSS
MQRAYAALGLPYLNQPQTQLQPQVPGQQPAQPQTHQQMRSLNPLGNNPMNIPAGGITTDQ
QPSNLISESALPTSLGATNPLMNDGSNSGNIGTLSTIPAAAPPSSTGVRKSWHEHVTQDL
RSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYK
IQKELEEKRRSRLHKQGILGNQPALSAPGTQPPGIPQAQPVRPPNGPMPLTVNRMQVSQG
MNSFNPISLGNVQLPQAPMGPRAASPMNHSVPMNSMGSVPGMAISPSRMPQPPNMMGAHA
NSMMAQAPAQSQFLPQSQFPSSSGALSVSSVGMGQPAAQAGVPQGQVPGAALPNPLNMLG
PQASQLPCPPVTQPPLHQTPPPASTAAGMPSLQHPAAPGVTPPQPAAPTQPSTPASSSGQ
TPTPTPGSVPSASQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHTQPP
GTPLSQTAASIDNRVPTPSSVASAETNSQQPGPEVPLLEMKAEIKTEDTEPDAGEPKGEP
GATMMEEDLQGSSQVKEETDPTEQKSEPMEVDEKKTEVKVEAKEEEEGSTNGTASQSTSP
SQPRKKIFKPEELRQALMSTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLST
IKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
YCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQ
PQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGR
TRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKS
RFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSI
HFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPK
RLQEWYKKMLDKAFAERIIHDYKDILKQANEDRLTSAKELPYFEGDFWPNVLEESIKELE
QEEEERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRTNKKKPSMPNVSNDL
SQKLYATMEKHKEVFFVIHLHAGPVIHTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWE
FSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKS
HTHKMVKWGLGLDDEGGSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQK
MKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQH
RLQQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVSMS
PAGFPSVARTQPPTTVSTGKPTNQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRVNI
NNGMPPGRTGMVTPVSQMAPVGLNVPRPGQVSGPVVPTLPAGQWQQAPIPQQQPMPGMPR
PVMSMQAQPAVAGPRMSGVQPPRSISPGALQDLLRTLKSPSSPQQQQQVLNILKSNPQLM
AAFIKQRTAKYVASQPGLQPQPGLQAQPGLHQQPGLQNLNAMQASGPRPGVPPQQQAMGG
LNPQGQALNIMNPGHNPSMASMNPQYREMLRRQLLQQQQQQQQQQQQQQQGSAGMAGGMA
GHSQFQQPPGPAGYPPAMPQQRMQQHLPMQGSAMGPMAAQMGQLGQMGQPGLGADSTPNI
QQALQQRILQQQQMKQQMGSPGQPNPMSPQQHMLSGQPQASHLPGQQMATSLSSQVRSPA
PVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSIDQGHLGNPEQSA
MLPQLNTPNRSALSSELSLVGDTTGDTLEKFVEGL
NT seq 7308 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaacttgctggacggaccgcccaaccccaaacgagccaaactcagctcgccc
ggcttctcggcgaatgacagcacagattttggatcattgtttgacttggaaaatgatctt
cctgatgagttgatccccaatggaggagaattaagccttttaaacagtgggaacctcgtt
ccagatgctgcttccaaacataaacaactgtccgagctcctgcgaggcggcagcagctcc
agcatcaacccgggaataggcaatgtgagtgccagcagccccgcgcagcaaggcctcggc
agccaggcccaggggcagcccagcagtgccaacatggccagtctgggtgccatgggcaag
agccctctgaaccagggagattcttccgcccccagcctgcctaagcaggcagccagcacc
tccgggcccactcctcctgcttcccaagcactgaatccgcaagcacaaaagcaagtgggg
ctggtgaccagcagccctgccacgtcgcagacgggacctgggatctgcatgaacgcaaac
ttcaaccaaacccacccaggcctcctcaatagtaactctggccacggtttaatgaaccag
gcccagcaaggacaggcgcaggttatgaatggatctcttggggctgctggccgaggaagg
ggagctgggatgccataccctactccggccatgcagggggccacaagcagtgtgctggct
gagacgttgacccaagtttcaccgcaaatggccagtcacgcagggctgaacaccgcacag
gccggaggcatgagcaagatgggaatgactggtaacacaagtccatttggacaacccttt
agtcaaactggagggcagcagatgggagcccctggagtgaaccctcagctgccgagcaag
cagagcatggtcaacagcttgcctccgtttgccgcagacatcaagaacgcttcagtcacc
aacgtgccaaacatgcctcagatgcaaacatcagtgggaattgtacccacccaggcgatt
gcaacgggccccaccgcagatcccgaaaaacgcaaactgatacagcagcagctggtccta
ctgcttcacgctcataaatgccagaggcgagaacaagccaatggagaggtccgggcctgc
gcactcccacattgtcggaccatgaaaaacgtcttgaatcacatgacgcattgtcaggct
gggaaggcttgtcaagttgcccattgcgcatcttcacgacaaatcatctctcattggaag
aactgcacacggcatgactgtcctgtttgcctccctttgaaaaatgccagtgacaagcga
aaccaacaaaccatcctggggtctccagctggtggaattcaaaacaccattggttctgtt
ggcacaggccaacagaatgccacttctttaagtaacccaaatccgatagaccccagctcc
atgcaacgagcgtatgctgctcttggactcccctacctgaaccagccccagacgcagctg
cagcctcaggttcctggccagcaaccagcacagcctcaaactcaccagcagatgaggagt
ctcaaccccctgggaaataacccaatgaacattccagcaggaggaataacaacagatcag
cagccatcaaacttgatttcagaatcagctcttccaacttcccttggggctacaaacccc
ctgatgaatgacggctcaaactctggaaacattggcaccctcagcactatacctgcagca
gcacctccttccagcaccggagttcggaaaagctggcacgaacacgtcactcaggacctg
cggagccatctagtgcataaacttgtccaagccatcttcccgacacctgaccctgcagcc
ctgaaggatcgccgcatggagaacctggtggcctacgctaagaaagtggaaggggacatg
tacgagtctgccaacagcagggatgaatactatcacttactagcagagaaaatctacaag
attcaaaaagagctagaagaaaagcggaggtcgcgtttacacaaacaaggcatcttgggt
aaccagccagccttatcagcccccgggacgcagccccctggaataccccaggcgcagcct
gtgagacctccaaatgggcccatgcctcttacagtgaatcgtatgcaggtttctcaaggg
atgaattcatttaacccaatatccttggggaacgtacagttgccacaagcgcccatggga
ccgcgtgcggcatcccccatgaaccactctgtcccgatgaacagcatgggctccgttcca
gggatggccatttctccgtcccgaatgcctcagcctccgaacatgatgggcgcgcacgcc
aacagcatgatggcccaggcgcctgcgcagagccagttcctcccgcagagccagttcccg
tcgtccagcggggcgctgagtgtgagcagcgtgggcatggggcagccggcggcgcaggct
ggcgttccacaggggcaagtgccaggggccgctcttcccaaccccctgaacatgcttggg
ccccaggccagccagctgccttgcccaccagtgacacagcctccgctgcatcagaccccg
cctcccgcctccacggccgccggcatgccgtctctgcagcacccagcagctcccggggtg
acgcccccccagccagctgcgcctacccagccttcaactcccgcgtcgtcttccgggcag
actcccaccccgactcctggctccgtgcccagcgccagccagacgcagagtactcctacg
gtccaggcagccgcccaggcccaggtgaccccgcagcctcagaccccagtgcagcctcca
tccgtggccaccccacagtcatcgcagcagcagccaacacctgtgcacacgcagcccccc
ggcaccccgctttcccagacagcagccagcattgataacagggtccccactccatcctca
gtggccagcgccgaaaccaactcccagcagccaggccccgaggtgccactgctggagatg
aaggctgagatcaagaccgaggacacagagcccgatgctggggagcccaagggagagcct
ggggctacgatgatggaggaggacttacaaggatcttctcaagttaaagaagaaacagac
ccgacagagcagaagtcagaaccaatggaagtggatgaaaagaaaactgaagtgaaggtc
gaagctaaagaggaagaagagggcagcaccaatgggacagcctctcagtccacgtcccct
tcgcagcctcgcaagaaaatcttcaagccggaggagttgcgccaggctctgatgtcaacc
ctggaagctctgtaccgacaggatccagagtccttaccctttcggcagcctgtggatccc
cagctcctgggaattccagattactttgacattgtgaagaatcccatggacctttccacc
atcaagcgtaagctggatacagggcagtaccaggagccctggcagtatgtagacgacgtc
tggctcatgttcaacaacgcctggctttacaatcggaagacatcccgggtctacaagttc
tgcagcaaacttgcagaggtctttgagcaggagattgaccccgtcatgcagtcccttggg
tattgctgtggacgcaagtatgagttttccccacagactctgtgctgctatgggaagcag
ctgtgtacaattcctcgagatgctgcctactacagctatcagaataggtatcacttctgt
gagaagtgtttcacagagatccagggggagaatgttaccctgggtgacgacccttcacaa
ccccagacgacaatttcaaaggatcagtttgaaaagaagaaaaatgataccttagatcct
gaaccttttgttgactgcaaggagtgtggccggaagatgcatcagatttgtgttctccac
tacgacatcatctggccctcaggttttgtatgtgacaactgcttgaagaaaacgggcaga
actcgaaaagaaaacaaattcagtgctaagagactacagaccacacggttgggaaaccac
ctggaagaccgagtcaacaagtttttgcggcgacagaatcaccctgaagctggcgaggtg
tttgtccgtgtggtggccagctcagacaagacagtggaggtcaagccagggatgaagtca
cggttcgtggattctggggagatgtcggagtctttcccatacagaactaaagcactcttt
gcctttgaggagattgacggggtggacgtgtgcttctttgggatgcacgtccaggagtac
ggctctgactgccccccgccaaacacaaggcgtgtgtacatatcttatctggacagtatt
catttcttccgaccccgatgcctccgaacagccgtttaccatgagatccttattggatat
ttagagtatgtgaagaaattggggtatgtgacagggcacatctgggcctgtcccccgagt
gaaggagatgactacatcttccactgccacccccctgatcaaaaaatccccaagccgaag
cgcctgcaagagtggtataagaagatgctggacaaggccttcgccgagcgcatcatccat
gactacaaggacattttgaaacaagcaaatgaagacaggctcaccagcgccaaggagctg
ccctactttgagggggacttctggcctaacgtgctggaggagagcattaaggagctggag
caggaggaggaagagaggaagaaggaggagagcaccgcggccagcgagaccacagagggc
agccagggcgacagcaagaacgccaagaaaaagaacaataagaaaaccaacaagaataaa
agcagcatcagccgcaccaacaagaagaagcccagcatgcccaacgtgtccaacgacctg
tcccagaaactctacgccaccatggagaagcacaaagaggtcttctttgtgatccacctc
cacgctgggcccgtcatccatacgctgccccccatcgtcgaccctgaccccctgctcagc
tgtgatctcatggacgggcgggatgccttccttacgctggcccgggacaagcactgggag
ttttcctccttgcggcgctccaagtggtccacgctgtgcatgctggtggagctgcacacc
cagggtcaggaccgcttcgtctacacctgcaacgagtgcaagcaccacgtggagacgcgc
tggcactgcaccgtgtgcgaggactacgacctctgcatcaactgctacaacacgaagagc
cacacccacaagatggtgaagtgggggctgggcctcgacgacgagggcggcagccagggc
gagccgcagtccaagagcccccaggagtcgcggcgcctgagcatccagcgctgcatccag
tcgctggtgcacgcctgccagtgccgcaacgccaactgctcactgccgtcctgccagaag
atgaagcgggtggtgcagcacaccaagggctgcaagcgcaagaccaacggcggctgcccg
gtgtgcaagcagctcattgccctctgctgctaccacgccaaacactgccaagaaaacaag
tgccccgtgcccttctgcctcaacatcaaacacaagctccgccagcagcagatccagcac
cgcctgcagcaggcccagctcatgcgccggcggatggccaccatgaacacccgcaacgtg
cctcagcagagcctgccttcccctacctcagcgccgcccgggacccccacgcagcagccc
agcacgccccagacgccgcagccccccgcccagccccagccctcgcctgtgagcatgtca
ccagctggcttccccagcgtggcccggactcagccacccacgacggtgtccaccgggaag
cccaccaaccaggtgcccgccccgccgccccccgcccagcccccacccgcggcggtggag
gcggcccggcagatcgagcgggaggcccagcagcagcagcacctgtaccgggtgaacatc
aacaacggcatgcccccggggcgcacgggcatggtgaccccggtgagccagatggccccc
gtgggcctgaacgttccccggcccggccaggtcagcgggcccgtcgtgcccaccctgcca
gccgggcagtggcagcaggcgcccatcccccagcagcagccgatgccgggcatgccccgg
cccgtgatgtccatgcaggcccagccagccgtggccgggccccggatgtccggtgtgcag
ccgccccggagcatctcgcccggcgccctccaggacctgctgcggaccctgaagtcgccc
agctccccgcagcagcagcagcaggtgctcaacatcctcaagtccaaccctcagctgatg
gcagctttcatcaaacagcgcacggccaagtacgtggccagccagcccggcctgcagcca
cagcctggcctccaggcccagcccggcctgcaccagcagcccggcctgcagaacctgaac
gccatgcaagccagcgggccgcggcctggcgtgcctccgcagcagcaggccatgggtggc
ctgaacccccagggccaagccctgaacatcatgaacccgggccacaaccccagcatggcg
agtatgaacccgcagtaccgagagatgctgaggaggcagctcctgcagcagcagcagcag
caacagcagcagcaacagcagcagcagcagggcagcgccggcatggccgggggcatggca
gggcacagccagttccagcagcccccaggccctgcgggctacccccctgccatgccgcag
cagcggatgcagcagcacctccccatgcagggcagcgccatgggcccgatggcggctcag
atggggcagctcggccagatggggcagcccgggctgggcgcagacagcacccccaacatc
cagcaggccctgcagcagcggattctgcagcagcagcagatgaagcagcagatggggtcc
ccgggccagccgaaccccatgagcccccagcagcacatgctctcaggacagcctcaggcc
tcgcacctccccggccagcagatggccacatccctcagtagccaggtgcggtctccggcc
cctgtccagtctccgcggccccagtcccagcctccacattccagcccgtcgccacggata
cagccccagccttcaccgcaccacgtctcgccccagactggttccccccacccaggactc
gcagtcaccatggccagctccatagatcagggacacttggggaaccccgaacagagtgca
atgctcccgcagctgaacacccctaaccggagtgcgttgtccagtgagctgtccctggtc
ggcgacaccacgggagacaccctagaaaagtttgtggagggtttgtag

DBGET integrated database retrieval system