KEGG   Bos taurus (cow): 505486Help
Entry
505486            CDS       T01008                                 

Gene name
ASPG
Definition
asparaginase homolog (S. cerevisiae)
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     505486 (ASPG)
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     505486 (ASPG)
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     505486 (ASPG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
Position
21
AA seq 571 aa AA seqDB search
MARAAGPERRLLAVYTGGTIGMRSERGVLVPGRGLAAVLKMLPMFHDEEHARARGLPEDT
LVLPPASPDQRVIYTVLECQPLFDSSDMTITEWVQIAQTIESHYARYDGFVVIHGTDTMA
FAASVLSFVLENLQKTVILTGAQVPIHALWNDGRENLLGALLLAGQYVIPEVCLFFQNQL
FRGNRVTKVDARRFAAFCSPNLPPLATVGADVTISQELVRRVRGQGRLVVHSSMERNVGL
LRLYPGIPASLVRAFLQPPMKGVVMETFGSGNGPTKPDLLQELRAAAERGLIIVNCTHCL
QGAVTSDYGAGMALSGSGTVSGFDMTSEAALAKLSYVLGLPGLSLDGRKELLARDLRGEM
TPPTVDEPRPSLRGGVLGRGVAQLLSLRQEADEVWDALVPSLACAAAYVGDLEALQVLVE
LGSDRSLEDFSGQTPLHAAARAGQAGAVTMLLQRGLDVNARDKGGLSPLLLAVGGRHRDV
IGLLRAAGACLSPQELEDSGTELCRLASRADCEGLRAWGQAGADLRQPGYDGRSALHVAE
VAGNLEVVALLQNLRGGAGDQAPGPEVLPGV
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcgcggcggggccggagcggcggctcttggccgtctacaccggcggcaccatc
ggcatgcggagcgagcgcggcgtgctcgtccccgggaggggcctggctgcagttctgaag
atgctgcccatgttccatgacgaggagcacgcccgggcccgcggcctccccgaggacacc
ctggtgctgccgccggccagccccgaccagagggtcatctacacagtgctggagtgccag
cccctctttgactccagtgacatgaccatcaccgagtgggtgcagatcgcccagaccatc
gagagccactacgcgcggtacgacggctttgtggtcatccacggcactgacaccatggcc
ttcgccgcctccgtgctctccttcgtgctggagaacctgcagaaaaccgtcatcctcacc
ggggcccaggtgcccatccacgccctgtggaatgacggccgggagaacctgctgggcgcc
ctgctgctggccggccagtacgtgatccccgaggtctgcctgttcttccagaatcagctg
tttcggggcaaccgggtgaccaaagtggacgcgcgcaggttcgcggccttctgctccccc
aacctgccgcctctggccaccgtgggcgctgacgtcacgatcagccaggagctggtgcgc
agagtccgcgggcagggccggctggtggtgcacagcagcatggagcggaacgtgggcctg
ctgcgcctctaccccgggatccccgcctccctggtccgggccttcctgcagccccccatg
aagggcgtggtcatggagaccttcggctccgggaacgggcccaccaagcccgacctgctt
caggagctgcgggcggcggccgagcgtggcctgatcatcgtcaactgcacccactgcctc
cagggtgccgtcacctccgactacggagccggcatggccttgagcggctctgggaccgtg
tcaggcttcgacatgacgtctgaggcagcactggccaagctgtcctatgtgctgggcctg
ccggggctgagcctggatggcaggaaggagctgctggccagggacctgcgcggggagatg
acgccgcccactgtggacgagccccggccctctctgcggggtggtgtgctggggcgcggg
gtcgcccagctcctcagtctgagacaggaggccgatgaggtgtgggacgccctggtgccc
agcctggcctgtgccgcggcctacgtgggtgacctggaggccctgcaggtgctggtagag
ctgggcagtgaccggagcctggaggacttcagtggccaaaccccactgcatgcggccgcc
cgggctggccaggctggggccgtcaccatgctgctgcagagagggctggacgtgaacgcc
cgggacaagggcggcctcagccccctgctgctggccgtggggggcaggcatagggatgtc
attgggctgctgcgggcagctggggcctgcctgtccccccaggagctggaggactcgggg
acggagctgtgccggctggcgtccagggcagactgtgagggcctgcgggcgtgggggcag
gcaggggccgacctgaggcagcccgggtatgatgggcgcagcgcgctgcacgtcgcagag
gtagctgggaacctggaagtggtggccctcctgcagaaccttcggggtggggctggtgac
caggctccaggcccagaagtgctgcctggtgtctaa

DBGET integrated database retrieval system