KEGG   Bos taurus (cow): 505619Help
Entry
505619            CDS       T01008                                 

Gene name
KAT5, HTATIP
Definition
K(lysine) acetyltransferase 5 (EC:2.3.1.48)
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
bta  Bos taurus (cow)
Pathway
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:bta00001]
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    505619 (KAT5)
Enzymes [BR:bta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     505619 (KAT5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
29
AA seq 513 aa AA seqDB search
MAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWVTH
ERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRFNLPK
EREAIPGGEPDQPLSSSSCLQPNHRSTKRKVEVVSPATPVPSETAPASVFPQNGSARRAV
AAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRH
RLKPWYFSPYPQELTALPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTIS
FFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKE
STEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQ
TILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDI
VDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggtgggggagataatcgagggctgccgcctgcccgtgctgcggcggaaccag
gacaacgaagatgagtggccactcgctgagattctgagcgtgaaggacatcagtggccgg
aagcttttctacgtccattacattgatttcaacaaacgcctggatgaatgggtgacccac
gagcggctggacctgaagaagatccagttccccaagaaagaggccaagacccccaccaag
aacgggcttcctgggtcccgacccggctctccagagagagaggtgccggcctccgcccag
gccagcgggaagaccttgccaatcccggttcagatcacactccgcttcaacctgcccaag
gagcgggaggccattcccggtggcgagcctgaccagccgctctcctccagctcctgcctg
cagcccaaccaccgctcaacgaaacggaaggtggaggtggtttcaccagcaactccagtg
cccagcgagactgccccggcctcagttttcccccagaatggatcagcccggagggcagtg
gcagctcagccggggcggaagcggaaatcgaattgcttgggcactgatgaggactcccag
gacagctcagatggaatcccgtctgctcctcgcatgactgggagcctggtatctgaccgg
agccacgacgacatcgtcacccggatgaagaacatcgagtgcattgagctgggccggcac
cgcctcaagccctggtacttctccccgtaccctcaggagctcaccgcgctgcctgtcctc
tacctctgcgagttctgcctcaagtatggccgaagcctcaagtgtctgcagcgtcatttg
accaagtgtgacctgcgacatcctcccggcaacgagatctaccgcaagggcaccatctcc
ttctttgagatcgacggacgtaagaacaagagttattcccaaaacctgtgtcttctggct
aagtgtttcctcgatcacaagacgttgtactatgacacagaccctttcctcttctacgtc
atgacagagtacgactgcaagggcttccatatagtgggctacttctccaaggaaaaggag
tccacggaagactacaacgtggcctgcatcctgaccctgcccccctaccagcgccggggc
tatggcaagctgctgatcgagttcagctatgaactctccaaagtggaagggaaaacgggg
acccctgagaagcccctctcggaccttggcctcctgtcctaccgaagctactggtcccag
accatcctggagatcttgatggggctgaagtcagagagcggggagaggccacagatcacc
atcaatgagatcagtgaaattaccagcatcaagaaggaggatgtcatatccactctgcaa
tacctcaacctcatcaactactacaagggccagtatatcctcaccctgtcggaagacatc
gtggatgggcacgaacgggctatgctcaaacggcttcttcggatcgactccaagtgtctg
cacttcactcccaaggactggagcaagaggggaaagtggtga

DBGET integrated database retrieval system