KEGG   Bos taurus (cow): 505677Help
Entry
505677            CDS       T01008                                 

Gene name
ALDH1L1
Definition
aldehyde dehydrogenase 1 family, member L1 (EC:1.5.1.6)
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
bta  Bos taurus (cow)
Pathway
One carbon pool by folate
Class
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:bta00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
22
AA seq 902 aa AA seqDB search
MKIAVIGQSLFGQEVYCRLREEGHEVVGVFTVPDKDGKADPLGLQAEQDGVPVFKFPRWR
AKGRALPDVVAQYLALGAELNVLPFCSQFIPMEVISAPRHGSIIYHPSLLPRHRGASAIN
WTLIHGDKKGGFTIFWADDGLDTGDLLLQKECEVLPDDTVSSLYNRFLFPEGVKGMVQAV
KLIAEGKAPRLPQPEEGATYEGIQRKETARIDWDQPAEAIHNWIRGNDKVPGAWTEACGQ
KLTFFNSTLSTAGLEPEGEDLPIPGAHRPGVITKAGLILFGNDGRMLLVKNIQLEDGKMI
PAAHFFEKVESSALELTEEELGTAEAVRGAWKRILPSVPEVDESTDFFKSGAASVDVVRL
VEEVKELCDGLELENEDVYMATTFGDFIQLLVRRLRGGDKETECAIDYVEKAVNKLTLRM
PHQLFIGGTFVDAEGGKTYETINPTDGSALCQVSLAQVSDVDKAVAAAKDAFENGLWGKI
SARDRGRLLYRLAELMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFAGWCDKI
QGSTIPINQARPNRNLTMTRREPIGVCGIIIPWNYPLMMLSWKTAACLAAGNTVVIKPAQ
VTPLTALKFAELTLKAGIPKGVVNVLPGSGSLVGQRLSDHPDVRKIGFTGSTEVGKHIMK
SCALSNVKKVSLELGGKSPLLIFADCDLGKAVQMGMSSVFFNKGENCIAAGRLFVEDSIH
DQFVRRVVEEVGKMKIGNPLDRDTNHGPQNHLAHLQKLLEYCQRGVEEGATLVCGGKQVP
RPGFFFEPTVFTDVQDHMFIAREESFGPIMIISRFADGDVDAVLTRANATEFGLASGVFT
RDINKALYVSDKLEAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKTVTF
EY
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcgcagtgatcggacagagcctgttcggccaggaggtctactgccgcctgcgg
gaggagggccatgaggtggtgggcgtgttcaccgtgcccgacaaggacgggaaggcagac
cccctcggcctgcaggctgagcaggacggcgtgccagtgttcaagttcccccgctggcgg
gccaaggggcgggccctgcccgacgtggtggcgcagtacctggccctgggagctgagctg
aacgtgctgcccttctgcagccagttcatccccatggaggtcatcagcgccccccggcac
ggctccatcatctaccacccgagcctgctgccgcgccaccggggcgcctctgccatcaac
tggaccctcatccacggggacaagaaaggggggtttaccatcttctgggcggacgacggt
ctggacaccggggaccttctgctccagaaggagtgtgaggtcctcccagatgacactgtc
agctccctctacaaccgctttctcttcccggaaggcgtcaaaggcatggttcaggctgtg
aagctgattgccgagggcaaagcccccagacttcctcagcccgaggagggcgccacctac
gaggggattcagaggaaggagacggccaggatcgactgggaccagccggcagaggccatc
cataactggatccgtgggaacgacaaggtgccgggcgcctggacggaggcctgtgggcag
aagctgacgtttttcaactcgacactgagcactgcgggcctggagcctgagggagaggac
ctgcccatcccgggcgcccaccggccaggggtgatcaccaaagcgggcctcatcctcttc
gggaatgacggccggatgctgctggtgaaaaacatccagctggaggatgggaagatgatc
ccagccgcacactttttcgagaaagtagagagcagcgccctggagctgacagaggaggag
ctgggcaccgcggaggctgtgcggggtgcctggaagcggatcctccccagtgtgccggag
gtggacgagtccacggacttcttcaagtctggggccgcatccgtggacgttgtcaggctg
gtggaggaagtcaaggagctgtgtgacggcctggaactggaaaatgaagatgtctacatg
gcaaccacctttggggacttcatccagctgttagtgagaaggctgcgagggggcgacaag
gagaccgagtgcgccatcgactacgtggaaaaagccgtgaacaagctgaccctccggatg
ccccatcagctgttcatcgggggcacatttgtggacgccgagggtggcaagacctacgag
accatcaacccgacagacggaagtgccctctgccaggtgtccctggcccaggtcagcgat
gtggacaaggccgtggccgctgcaaaggacgcctttgagaacggactgtgggggaagatc
agcgcgcgggaccgtggccgcctcctgtacaggctggcagagctcatggagcagcaccag
gaggagctggccaccatcgaggccctggatgcaggtgcggtctacacgctggccctgaag
acacacgtgggcatgtccatccagaccttccgctacttcgctggctggtgcgacaagatc
cagggctccaccatccccatcaaccaggcgagacccaaccggaacctgaccatgacccgg
agggagcccatcggggtctgcggcatcatcatcccctggaactatcccctgatgatgctg
tcctggaagacggccgcctgcctggctgcaggcaacacagtggtgatcaagcctgcccag
gtcaccccactcacggccttgaagtttgcggagctgaccctgaaggcgggcatccctaag
ggcgtggtcaacgtcctgccaggatccggctcactggtcggccagagactgtcagatcac
ccggacgtgcggaagattgggttcacagggtccaccgaggtcggcaagcacattatgaaa
agctgcgccctgagcaatgtgaagaaggtctccctggagctgggtgggaagtcacccctc
ctcatcttcgcggactgtgacctgggcaaggccgtgcagatgggtatgagctctgtcttc
ttcaacaaaggtgagaactgcatcgccgccggccggctctttgtggaggactccatccac
gaccagtttgtgcggagagtggtagaggaggtggggaagatgaagattggcaatcccctg
gatcgggacaccaaccacgggccgcagaatcacctggcccacctgcagaagctgctggag
tactgccagcgcggcgtggaggagggggccacgctggtgtgcggcgggaagcaggttcct
cggccaggcttcttcttcgagccgacggtcttcacagacgtgcaggaccacatgttcata
gcccgggaggagtcctttgggcccatcatgatcatctctcggtttgctgatggcgacgtg
gacgcagtgctgactcgggccaatgccacggagttcggcctggcctctggcgtcttcacc
agggacatcaacaaggccctgtacgtcagcgacaagctggaggctggcaccgtgttcgtc
aacacatacaacaagactgacgtggccgctcccttcggggggttcaagcagtcagggttc
ggcaaagacctgggagaggcagccctgaacgagtacctgcgggtcaagacggtaaccttc
gagtactga

DBGET integrated database retrieval system