KEGG   Bos taurus (cow): 505757Help
Entry
505757            CDS       T01008                                 

Gene name
PPP2R5C
Definition
protein phosphatase 2, regulatory subunit B', gamma
Orthology
K11584  
serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
bta  Bos taurus (cow)
Pathway
mRNA surveillance pathway
Oocyte meiosis
PI3K-Akt signaling pathway
Adrenergic signaling in cardiomyocytes
Dopaminergic synapse
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:bta03015]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:bta04151]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:bta04114]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:bta04261]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:bta04728]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
21
AA seq 524 aa AA seqDB search
MLTCNKAGSRMVVDAASSNGPFQPVALLHIRDVPPADQEKLFIQKLRQCCVLFDFVSDPL
SDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFAVNMFRTLPPSSNPTGAEFDP
EEDEPTLEAAWPHLQLVYEFFLRLLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERD
FLKTTLHRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLK
EEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVMALLKYWPKTHSPK
EVMFLNELEEILDVIEPSEFVKIMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLIS
DNAAKILPIMFPSLYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEK
LKMKEREEAWVKIENLAKANPQYAVYSQASTISIPVAMETDGPLFEDVQMLRKTVNEEAR
QAQKDPKKERPLARRKSELPQDLHTKSALEAHGRAEEPAPQDGR
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgttgacatgtaataaagcgggcagcaggatggtggtggatgcggccagctccaatggg
cctttccagcccgtggcccttctccatattcgagatgttcctcctgctgatcaagagaag
ctttttatccagaagttacgtcagtgttgtgtcctctttgactttgtttccgatccacta
agtgacctaaagtggaaggaagtaaaacgagctgctttaagtgagatggtagaatatatc
acccataatcggaatgtgatcacagagcctatttacccagaagtagtccatatgtttgca
gttaacatgtttcgaacgttaccaccttcctccaaccccacgggagcagaatttgaccca
gaggaagacgagccaacgttagaagcagcctggcctcacctgcagcttgtttatgagttt
ttcttaagacttttagagtctccagatttccaacctaatatagcgaagaaatatattgat
cagaagtttgtattgcagcttttagagctctttgacagtgaagatccccgcgagagagat
tttctcaaaactacccttcacagaatctatggaaaattcttaggcttaagagcttacatc
agaaaacagataaataatatattttatagatttatttatgaaacagagcatcacaatggc
atagcagaattactggaaatattgggaagtataattaacggatttgccttaccactaaaa
gaagagcacaagattttcttattgaaggtgttattacctttgcacaaagtgaagtctctg
agcgtctaccatccgcagctggcctactgcgtggtgcagtttttagagaaggacagcacc
ctcactgagccggtggtaatggcacttctcaagtactggccaaagacccacagtccaaaa
gaagtcatgttcctgaacgaattggaagagattctggatgtcattgagccgtcagagttc
gtgaagatcatggagcctcttttccggcagctggccaagtgcgtctccagccctcacttc
caggtggcggagcgggcgctgtactactggaacaacgagtacatcatgagcctgatcagc
gacaacgcggccaagatcctgcccatcatgttcccgtccctgtaccgcaactccaagacc
cactggaacaagacaatacatggcttgatatacaacgcactgaagctcttcatggagatg
aaccaaaaactgtttgatgactgcacccagcagtttaaagcagagaaactgaaagagaag
ctaaaaatgaaagaacgagaagaagcgtgggttaaaatagaaaacctagccaaagcaaac
ccccagtacgcagtgtatagtcaagcgagcaccatcagcatcccggtggcaatggagaca
gatgggcctttatttgaagatgtgcagatgctgagaaagacagtgaacgaagaggctcgc
caggcacagaaggacccgaagaaggagcggcccctggcgcgccgcaagtccgagcttccc
caggacctgcacaccaagagcgccctggaggcccacggccgcgccgaggagccggcgccc
caggacgggcgctag

DBGET integrated database retrieval system