KEGG   Bos taurus (cow): 505757Help
Entry
505757            CDS       T01008                                 

Gene name
PPP2R5C
Definition
protein phosphatase 2, regulatory subunit B', gamma
Orthology
K11584  
serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
bta  Bos taurus (cow)
Pathway
mRNA surveillance pathway
Oocyte meiosis
PI3K-Akt signaling pathway
AMPK signaling pathway
Adrenergic signaling in cardiomyocytes
Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:bta00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    505757 (PPP2R5C)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    505757 (PPP2R5C)
   04152 AMPK signaling pathway
    505757 (PPP2R5C)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    505757 (PPP2R5C)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    505757 (PPP2R5C)
  Nervous system
   04728 Dopaminergic synapse
    505757 (PPP2R5C)
Protein phosphatases and associated proteins [BR:bta01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     505757 (PPP2R5C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
21
AA seq 524 aa AA seqDB search
MLTCNKAGSRMVVDAASSNGPFQPVALLHIRDVPPADQEKLFIQKLRQCCVLFDFVSDPL
SDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFAVNMFRTLPPSSNPTGAEFDP
EEDEPTLEAAWPHLQLVYEFFLRLLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERD
FLKTTLHRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLK
EEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVMALLKYWPKTHSPK
EVMFLNELEEILDVIEPSEFVKIMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLIS
DNAAKILPIMFPSLYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEK
LKMKEREEAWVKIENLAKANPQYAVYSQASTISIPVAMETDGPLFEDVQMLRKTVNEEAR
QAQKDPKKERPLARRKSELPQDLHTKSALEAHGRAEEPAPQDGR
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgttgacatgtaataaagcgggcagcaggatggtggtggatgcggccagctccaatggg
cctttccagcccgtggcccttctccatattcgagatgttcctcctgctgatcaagagaag
ctttttatccagaagttacgtcagtgttgtgtcctctttgactttgtttccgatccacta
agtgacctaaagtggaaggaagtaaaacgagctgctttaagtgagatggtagaatatatc
acccataatcggaatgtgatcacagagcctatttacccagaagtagtccatatgtttgca
gttaacatgtttcgaacgttaccaccttcctccaaccccacgggagcagaatttgaccca
gaggaagacgagccaacgttagaagcagcctggcctcacctgcagcttgtttatgagttt
ttcttaagacttttagagtctccagatttccaacctaatatagcgaagaaatatattgat
cagaagtttgtattgcagcttttagagctctttgacagtgaagatccccgcgagagagat
tttctcaaaactacccttcacagaatctatggaaaattcttaggcttaagagcttacatc
agaaaacagataaataatatattttatagatttatttatgaaacagagcatcacaatggc
atagcagaattactggaaatattgggaagtataattaacggatttgccttaccactaaaa
gaagagcacaagattttcttattgaaggtgttattacctttgcacaaagtgaagtctctg
agcgtctaccatccgcagctggcctactgcgtggtgcagtttttagagaaggacagcacc
ctcactgagccggtggtaatggcacttctcaagtactggccaaagacccacagtccaaaa
gaagtcatgttcctgaacgaattggaagagattctggatgtcattgagccgtcagagttc
gtgaagatcatggagcctcttttccggcagctggccaagtgcgtctccagccctcacttc
caggtggcggagcgggcgctgtactactggaacaacgagtacatcatgagcctgatcagc
gacaacgcggccaagatcctgcccatcatgttcccgtccctgtaccgcaactccaagacc
cactggaacaagacaatacatggcttgatatacaacgcactgaagctcttcatggagatg
aaccaaaaactgtttgatgactgcacccagcagtttaaagcagagaaactgaaagagaag
ctaaaaatgaaagaacgagaagaagcgtgggttaaaatagaaaacctagccaaagcaaac
ccccagtacgcagtgtatagtcaagcgagcaccatcagcatcccggtggcaatggagaca
gatgggcctttatttgaagatgtgcagatgctgagaaagacagtgaacgaagaggctcgc
caggcacagaaggacccgaagaaggagcggcccctggcgcgccgcaagtccgagcttccc
caggacctgcacaccaagagcgccctggaggcccacggccgcgccgaggagccggcgccc
caggacgggcgctag

DBGET integrated database retrieval system