KEGG   Bos taurus (cow): 505839Help
Entry
505839            CDS       T01008                                 

Gene name
USP20
Definition
ubiquitin specific peptidase 20 (EC:3.4.19.12)
Orthology
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.4.19.12]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     505839 (USP20)
Peptidases [BR:bta01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   505839 (USP20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
11
AA seq 912 aa AA seqDB search
MGDSRDLCPHLDSIGEVTKEDLLLKSKSTCQSCGVSGPNLWACLQVSCSYVGCGESFADH
STLHAQAKKHNLTVNLTTFRVWCYACEKEVFLEPRLAAHPPGPAPKFSEQDSPPPSHPLK
AVPIAVADEGESESEDDDLKPRGLTGMKNLGNSCYMNAALQALSNCPPLTQFFLECGGLV
RTDKKPALCKSYQKLVSEVWHRKRPSYVVPTSLSHGIKLVNPMFRGYAQQDTQEFLRCLM
DQLHEELKEPVVATAAALTEARDSDSSDTDEKREGDRSPSEDEFLSCDSSSDRGEGDGQG
RSGGGSQAEAELLMADEAGRAISEKERMKDRKFSWGQQRTNSEQVDEDADVDTAMAALEQ
QPPETQPPSPRSTSPCRTPEPDNEAHMRSSRPCSPVHHHEGHAKLASSPHRASPVRMGPA
YVLKKAQVPGSRRRKEQSYRSVISDIFDGSVLSLVQCLTCDRVSTTVETFQDLSLPIPGK
EDLAKLHSAIYQNVPAKPGACGDSYVAQGWLAFIVEYIRRFVVSCTPSWFWGPVVTLEDC
LAAFFAADELKGDNMYSCERCKKLRNGVKYCKVLRLPEILCIHLKRFRHEVMYSFKISSH
VSFPLEGLDLRPFLAKECTSQITTYDLLSVICHHGTAGSGHYIAYCQNVINGQWYEFDDQ
YVTEVHETVVQNAEAYVLFYRKSSEEAVRERQQVVSLAAMREPSLLRFYVSREWLNKFNT
FAEPGPITNHTFLCSHGGIPPNKYHYIDDLVVILPQNVWEHLYSRFGGGPAVNHLYVCSI
CQVEIEALAKRRRVEIDTFIKLNKAFQAEESPSVIYCISMQWFREWEAFVKGKDNEPPGP
IDNSRIAQVKGSGHIQLKPGADYGQISEETWVYLNNLYGGGPEIAIRQSVAQLPDPESLH
GEQKIEAETRAL
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atgggggactccagggacctttgtcctcatcttgactcgataggggaggtgaccaaagag
gacttgctgctcaaatccaagagcacctgtcagtcatgcggggtttctggacccaacctg
tgggcctgtctccaggtctcctgctcctacgttggctgcggagaatccttcgctgaccac
agcaccctgcacgcacaggcgaaaaagcacaacctgacggtgaacctgaccacgttccgg
gtgtggtgctacgcctgtgagaaggaagtgttcctggagccgcgcctggcggcccacccg
cctggccccgcgcccaagttctcagagcaggactctccgccaccctcccaccctctgaaa
gccgtccccatcgctgtggcggacgaaggagagtccgagtcggaggacgacgacctgaag
ccacgaggcctcacgggcatgaagaacctcggcaactcctgctacatgaatgcggccttg
caggctctgtccaactgccccccgctcacccagttcttcttggagtgtggaggcctggtc
cgcacagacaagaagccagccctgtgcaaaagttatcagaagctggtctctgaggtctgg
cacaggaaacgccccagctatgtggttcccaccagcctgtcccatgggatcaagttggtc
aacccaatgttccgaggctatgcccagcaggacacccaggaattcttgcgctgcctgatg
gaccagctgcacgaggaactcaaggagcccgtggtggccacagcggcggcgctgaccgag
gcgcgggactcggactcgagcgacacggatgagaagcgggagggtgaccggagcccctca
gaggacgagttcctgtcctgcgactccagcagcgaccgcggcgagggcgacgggcagggg
cgcagcgggggaggctcccaggccgaggcggagctgctgatggcggacgaggcgggccgc
gccatctccgagaaggagcgcatgaaggaccgcaagttctcgtggggccagcagcgcacc
aactcggagcaggtggacgaggacgccgacgtggacaccgccatggccgccctggagcag
cagcccccggagacgcagcccccctccccgcggtccaccagtccctgccggacgccagag
ccggacaacgaggcgcacatgcgcagctcccggccctgcagccccgtccaccaccacgaa
ggccacgccaagctggccagcagccctcatcgtgcgagccctgtgaggatggggccggcc
tatgtgctcaagaaagcccaggtccccggcagccggcggcggaaggagcagagctaccgc
agcgtcatctcggacatcttcgacggctccgtcctcagcctcgtgcagtgtctcacctgt
gaccgggtgtccaccactgtggagacattccaggacctgtcactgcccattcctggcaag
gaggacctggccaaactccactcggccatctaccagaacgtgccggccaagccgggtgcc
tgcggggacagctatgtggcccagggctggcttgcctttattgtggagtatatccgacgg
ttcgtggtgtcctgtacccctagctggttttgggggccagtcgtcaccctggaagactgc
ctggctgccttctttgctgctgatgagctgaagggtgacaacatgtacagctgtgaacgg
tgtaaaaagctgcgcaacggggtgaagtactgtaaggtcttgcggttgccggagatcctg
tgcattcacctgaagcgctttaggcacgaggtcatgtactctttcaagatcagcagccat
gtgtccttccccctcgagggccttgacctgcgccccttcctcgccaaggagtgcacgtcc
cagatcaccacctatgacctcctctcggtcatctgccaccacggcacggcaggcagtggc
cactacatcgcctactgccagaacgtgatcaacgggcagtggtatgagttcgacgaccag
tacgtcaccgaggtccacgagacggtggtgcagaacgcggaggcctacgtgctcttctac
aggaagagcagcgaggaagctgtgcgggagcgacagcaggtggtgtccctggccgccatg
cgggagcccagcctgctgcggttctacgtgtcccgggaatggctcaacaagtttaacacc
ttcgcggagccagggcccatcaccaaccacacgttcctctgctcccacggagggatcccg
cccaacaaatatcactacatcgatgacctggtggtgatcctgccgcagaacgtgtgggag
cacctctacagcaggtttgggggcggccccgctgtgaaccatctgtacgtgtgctccatc
tgccaggtggagatcgaggctctggccaagcgcaggcgggtggagatcgacaccttcatc
aagctgaacaaggcgttccaggccgaggagtcgcccagcgtcatctactgtatcagcatg
cagtggttccgagagtgggaggccttcgtcaagggcaaggacaacgagcccccggggccc
attgacaacagcaggatcgcacaggtcaaaggaagcggccacatccagctgaagccggga
gctgactatgggcagatctccgaggagacctgggtgtacctgaacaacctctatggcggc
ggccccgagattgccatccgccagagcgtggctcagctcccggacccggagagcttgcac
ggtgaacagaagattgaagccgagacccgggccttgtga

DBGET integrated database retrieval system