KEGG   Bos taurus (cow): 505903Help
Entry
505903            CDS       T01008                                 

Definition
histone H2B type 1-like
Orthology
K11252  
histone H2B
Organism
bta  Bos taurus (cow)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:bta05203]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:bta05322]
Human Diseases; Substance dependence; Alcoholism [PATH:bta05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
7
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKAQKKDSKKRKSSRKESYSVYVYKVLKQVHLDTGISSKAM
GIMNSFIKDIFQHITGEASCLVHYNKCSTITSREIQTSVRLLLPGELAKQAMSEGTKAVI
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaccggctaagtctgctcctgcccctaaaaagggctctaaaaaagctgtgacc
aaggcccagaagaaagacagcaagaagcgcaagagcagccgcaaggagagctactccgtg
tacgtgtacaaggtgctgaagcaagtccatctggataccggcatctcgtccaaggccatg
ggaatcatgaactccttcatcaaggacatattccagcacatcactggtgaggcatcgtgc
ctggtgcattacaacaagtgctcgactatcacatccagggagatccagacctctgtgcgc
ttgctgctacctggggagctggccaagcaggccatgtccgagggcactaaggctgtcatc
aagtataccagctccaagtaa

DBGET integrated database retrieval system