KEGG   Bos taurus (cow): 505987Help
Entry
505987            CDS       T01008                                 

Gene name
GK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bta  Bos taurus (cow)
Pathway
Glycerolipid metabolism
Metabolic pathways
PPAR signaling pathway
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bta00561]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:bta03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
X
AA seq 559 aa AA seqDB search
MASAKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEI
LQSVYECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKLTGEPLYNAVVWLDLRTQ
STVESLSKRIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVRKVQKAVEEDRALFGTIDS
WLIWSLTGGASGGVHCTDVTNASRTMLFNIHSLEWDKELCEFFEIPMKILPNVRSSSEIY
GLMKISHSPKAGALEGVPISGCLGDQSAALVGQMCFQDGQAKNTYGTGCFLLCNTGRKCV
FSEHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKSSEEIEKLAKEVGT
SYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRD
CGIPLSHLQVDGGMTNNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSL
EPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKSMGWVTTQSSESGDPSIFCSLPLGF
FIVSSVVMLIGARYLSGMP
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggcatccgcgaagaaagcagttttggggcccttggtgggagcagtggaccagggcacc
agctcgacgcgctttctggttttcaattcaaaaacagccgaactacttagtcatcatcaa
gtggaaataaaacaagagtttccaagagaagggtgggtggagcaggaccctaaggaaatt
ctgcagtctgtctatgagtgtatagagaaaacgtgtgagaaactcgggcagctcaatatt
gatatttccaacataaaagctattggtgtcagtaaccagagggaaaccactgtagtctgg
gacaagttaactggagaacctctctacaacgctgtggtgtggcttgacctaagaacccag
tctactgttgagagtcttagtaaaagaatcccaggaaataataactttgtcaagtccaag
acaggccttccacttagcacttatttcagtgcggtgaagcttcgttggctccttgacaat
gtgagaaaagttcaaaaggccgttgaagaagatagagctctttttgggaccattgattca
tggcttatttggagcttgacaggaggagccagtggaggggtccattgtacagatgtaaca
aatgcaagcaggacaatgcttttcaacatccattctttggaatgggataaagagctctgc
gaattttttgaaattccaatgaaaattcttccaaatgtccggagttcttcagagatctat
ggcctaatgaaaatctctcatagcccgaaagctggggccttggaaggtgtgccaatatct
gggtgtttgggagaccagtctgctgcgttggtaggacaaatgtgcttccaagatggacaa
gccaaaaacacgtatggaacaggctgcttcttactatgtaatacaggccgtaagtgtgta
ttttctgaacatggccttctgaccacagtggcttacaaactcggcagagataaacccgta
tattatgcattagaaggttcagtagctatagctggtgctgttattcgctggcttagagac
aatcttggaattataaaaagctccgaggaaattgaaaaacttgctaaagaagtaggtact
tcttatggctgctatttcgtcccagcattttcggggctgtatgcaccttattgggagccc
agtgcaagagggatcatctgtgggctcactcagttcaccaataaatgccatattgctttt
gctgcattagaagctgtttgtttccaaactcgagagattttggacgccatgaaccgtgac
tgtggaattccactcagccatttgcaggtagatggtggaatgaccaacaacaaaatcctt
atgcagttacaagcagacattctgtatattccagtagtgaaaccatccatgcctgaaaca
actgctctgggagccgccatggctgcaggggctgcagaaggggttggcgtctggagtctg
gagcctgaggacttgtcggctgtcacaatggagcgatttgaacctcagatcaacgctgag
gaaagtgaaattcgttattctacatggaagaaagctgtgatgaaatcaatgggttgggtt
acaactcagtcttcagaaagtggtgaccctagtatcttctgtagtctgcccttgggcttt
tttatagtgagtagcgtggtaatgttaatcggagcaaggtacctctcaggtatgccgtaa

DBGET integrated database retrieval system