KEGG   Bos taurus (cow): 505987Help
Entry
505987            CDS       T01008                                 

Gene name
GK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bta  Bos taurus (cow)
Pathway
Glycerolipid metabolism
Metabolic pathways
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    505987 (GK)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    505987 (GK)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     505987 (GK)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   505987 (GK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
X
AA seq 559 aa AA seqDB search
MASAKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEI
LQSVYECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKLTGEPLYNAVVWLDLRTQ
STVESLSKRIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVRKVQKAVEEDRALFGTIDS
WLIWSLTGGASGGVHCTDVTNASRTMLFNIHSLEWDKELCEFFEIPMKILPNVRSSSEIY
GLMKISHSPKAGALEGVPISGCLGDQSAALVGQMCFQDGQAKNTYGTGCFLLCNTGRKCV
FSEHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKSSEEIEKLAKEVGT
SYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRD
CGIPLSHLQVDGGMTNNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSL
EPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKSMGWVTTQSSESGDPSIFCSLPLGF
FIVSSVVMLIGARYLSGMP
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggcatccgcgaagaaagcagttttggggcccttggtgggagcagtggaccagggcacc
agctcgacgcgctttctggttttcaattcaaaaacagccgaactacttagtcatcatcaa
gtggaaataaaacaagagtttccaagagaagggtgggtggagcaggaccctaaggaaatt
ctgcagtctgtctatgagtgtatagagaaaacgtgtgagaaactcgggcagctcaatatt
gatatttccaacataaaagctattggtgtcagtaaccagagggaaaccactgtagtctgg
gacaagttaactggagaacctctctacaacgctgtggtgtggcttgacctaagaacccag
tctactgttgagagtcttagtaaaagaatcccaggaaataataactttgtcaagtccaag
acaggccttccacttagcacttatttcagtgcggtgaagcttcgttggctccttgacaat
gtgagaaaagttcaaaaggccgttgaagaagatagagctctttttgggaccattgattca
tggcttatttggagcttgacaggaggagccagtggaggggtccattgtacagatgtaaca
aatgcaagcaggacaatgcttttcaacatccattctttggaatgggataaagagctctgc
gaattttttgaaattccaatgaaaattcttccaaatgtccggagttcttcagagatctat
ggcctaatgaaaatctctcatagcccgaaagctggggccttggaaggtgtgccaatatct
gggtgtttgggagaccagtctgctgcgttggtaggacaaatgtgcttccaagatggacaa
gccaaaaacacgtatggaacaggctgcttcttactatgtaatacaggccgtaagtgtgta
ttttctgaacatggccttctgaccacagtggcttacaaactcggcagagataaacccgta
tattatgcattagaaggttcagtagctatagctggtgctgttattcgctggcttagagac
aatcttggaattataaaaagctccgaggaaattgaaaaacttgctaaagaagtaggtact
tcttatggctgctatttcgtcccagcattttcggggctgtatgcaccttattgggagccc
agtgcaagagggatcatctgtgggctcactcagttcaccaataaatgccatattgctttt
gctgcattagaagctgtttgtttccaaactcgagagattttggacgccatgaaccgtgac
tgtggaattccactcagccatttgcaggtagatggtggaatgaccaacaacaaaatcctt
atgcagttacaagcagacattctgtatattccagtagtgaaaccatccatgcctgaaaca
actgctctgggagccgccatggctgcaggggctgcagaaggggttggcgtctggagtctg
gagcctgaggacttgtcggctgtcacaatggagcgatttgaacctcagatcaacgctgag
gaaagtgaaattcgttattctacatggaagaaagctgtgatgaaatcaatgggttgggtt
acaactcagtcttcagaaagtggtgaccctagtatcttctgtagtctgcccttgggcttt
tttatagtgagtagcgtggtaatgttaatcggagcaaggtacctctcaggtatgccgtaa

DBGET integrated database retrieval system