KEGG   Bos taurus (cow): 506194Help
Entry
506194            CDS       T01008                                 

Gene name
TACC3
Definition
transforming, acidic coiled-coil containing protein 3
Orthology
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
bta  Bos taurus (cow)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:bta00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    506194 (TACC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
6
AA seq 810 aa AA seqDB search
MSLHLFSDENVTGDKSRENCDFLFSPPELTGRASVLRLSQKENVPPKSTAKTVKVTFQTP
LRDPQTYRILSPSVGSKLEACFVLGDPIELENCHQVCTQKENQQFTKETDTKTTHGILQK
PVPVNTEPPSEDMRPVSEDQPPGGPPSAPLVSLGPSSSSQIPESVENPEASRGPAPGSPE
CAREEHVHPWPSEESMPLGPMAPEQPSGVVSQDTAEDPLSGTGGDSEGVPGPPARPASPC
GAPPGEKPLVDLPGAAPVGSMDATSREDTALTGPGEAAGATHPGAQGEETCGQAASSLRS
GPVRLEFDFSDATGKRSPPLRKRGKALGLKPPSRRPEARPGKATLEAGKGCELTLRGSDG
PSWDKPDDPDCNPAADSGEARPLEHPQSGQATEALSLSRQACSDDTPGTRAPARTPGAAG
EGWTTGSLGGSAPLSSPSSEPPTAPTNPTPPTERGPEPTLDLNGEQFRDPAEVLGAGAEL
DYLEQFGAPSFKESALRKQSLYLNFDPLLQDSPQGLTPSSSGRPRGLPVPSAGPLASEES
PGLMQTAGGFSLGLRARSVDKPSSGSPPEAQLLDLDFPGAPGIPIPGLAPCDLGPGAPLL
PVGPIVDVLQYSQKDLDSAVEATQKENEVLRGKCAALQERLLEMGKIMDSFEGTVYQVME
ESQKQKELTKAEMQKVLKEKAQLTADLHSMEKSFSDLFKRFEKQKEVIEGYRTNEESLKK
CVEDYIERVEKEAQKYQALKAQAEEKLRQASEEIAQVRSKAQTDALALQAVLRKEQMRVH
SLEKVVEQKTKENDELTRICDDLISKMKRI
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgcatctcttcagcgacgaaaacgtcactggtgacaaaagtagggaaaattgc
gacttcctgttttcacccccggaacttaccggaagggcgtccgttctccgtctgtcacag
aaagagaatgtgccgccgaagagcacagccaaaactgtgaaggtgacttttcagacacct
ctacgggacccacagacatacaggatcttaagtcccagcgtgggcagcaagctcgaagcc
tgttttgttctgggtgaccccattgaattagaaaactgccatcaagtctgtacccagaaa
gagaatcaacagttcaccaaggaaacagacaccaaaacgacccatggaattctccagaag
ccagtaccagtcaacaccgagcccccctcagaggacatgagaccagtctctgaagaccag
cctcctggtgggcccccctcagctcctctggtcagcctgggtccctcaagctcttcccag
ataccagagagtgttgaaaacccggaggcctcccgaggaccagcacccggcagccctgag
tgtgcccgggaagagcacgtccacccttggccctcagaggagagcatgcccctcggcccc
atggctccagaacagccctctggggtggtgtcccaggacacagcagaggacccactcagc
ggtacgggaggggactcagagggggtccctggtccccctgccaggcccgcctcgccctgt
ggtgccccccctggagaaaaacccctcgtggacctgcctggagcggccccagtgggctcc
atggatgccaccagccgcgaggacacggctctgaccggccctggagaggctgcgggggcc
acacaccccggtgctcagggggaggagacctgtggccaggccgccagctctctgaggagc
ggtcctgtccggctggagttcgacttctctgatgccaccggcaaaaggtctcccccactg
cggaagcgagggaaggccctgggtctcaagcccccctcgaggagaccagaggcgaggccc
ggaaaggccaccctggaggcgggcaagggttgcgagctcactctgcgtgggtccgacggc
ccgagctgggacaagccagacgacccagactgtaacccggccgcagacagtggcgaggcc
cggcccctggagcacccgcagagcggccaggccacagaggccttgtctctgagccggcag
gcgtgctcagatgacacacccgggacgagggccccagcgaggaccccaggagcggcgggc
gaggggtggaccacaggctctttggggggttcggcacccctcagcagcccaagtagcgag
ccaccgactgcacccaccaaccctacaccccccaccgagagggggccggagcccaccctg
gacctgaacggggagcagttccgggaccccgcggaggtcctaggcgcgggggcagagttg
gactacctggagcagttcggggcgccctcgtttaaagagtcagccctgaggaagcagtcg
ctgtacctcaacttcgacccgctcctgcaggacagtccccaggggctgacacccagcagc
agcggcaggccgcggggcctacctgtcccgagcgcgggccctctggcctccgaggagagc
cccgggctcatgcagacagcaggtggcttctctcttggtctccgtgctcgcagtgtggac
aagccttcctctggaagccccccggaggcccagctgcttgacctggacttccctggagcc
ccgggcattcctatacctggcctggctccgtgtgaccttgggcccggggctccactgctg
cctgtggggccgatcgtggacgtgctgcagtacagccagaaggacctggactcggcggtg
gaggccacgcagaaggagaacgaggtgctgcggggcaagtgcgcggcgctgcaggagagg
ctcctggagatggggaagatcatggacagctttgaggggactgtctaccaggtgatggag
gagtctcagaaacagaaggagctcaccaaggccgaaatgcagaaggtcctgaaggagaag
gcacagctgacggccgacctgcactccatggaaaagtcgttctccgaccttttcaagcgg
tttgagaaacagaaggaggtgatcgaaggctaccgcacgaacgaagagtcactgaagaag
tgtgtcgaggattacatagagagggtggagaaggaggcccagaagtaccaggcactgaag
gcccaggcggaggagaagctccggcaggcaagtgaggagatcgcccaggtccgcagcaag
gcccagactgacgctctggcgctgcaggcggtcctgaggaaggagcagatgcgtgtccac
tccctggagaaggtggtggagcagaagactaaagagaatgatgagctgaccaggatctgt
gacgacctcatttccaagatgaagagaatctga

DBGET integrated database retrieval system