KEGG   Bos taurus (cow): 506459Help
Entry
506459            CDS       T01008                                 

Gene name
ACSS2
Definition
acyl-CoA synthetase short-chain family member 2 (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bta  Bos taurus (cow)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bta01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bta00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bta00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bta00640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
13
AA seq 701 aa AA seqDB search
MGLPEERSRSGSGSGAREEAGARSPTRSWSPPPEVSRSAHVPSLQRYRELHRRSLEEPRE
FWGDIAKEFYWKTPCPGPFLQYNFDVTKGKIFIEWMKGATTNICYNVLDRIVHEKKLGDK
VAFYWEGNEPEETTQITYRELLVQVCRFSNVLRKQGICKGDRVAIYMPMIPELVVAMLAC
ARLGALHSIVFAGFSSESLCERILDSNCSLLITTDAFYRGEKLVNLKELADEALEKCQEK
GFPVKCCIVVKHLGRAELVTGDSPSQSPPIKRPCPDVQISWNEGVDLWWHELMQKAGDEC
EPEWCDAEDPLFILYTSGSTGKPKGVLHTVGGYMLYVATTFKYVFDFHAEDVFWCTADIG
WITGHSYVTYGPLANGATSVLFEGIPTYPDVSRLWNIVEKYKVTKFYTAPTAIRLLMKFG
DEPVTKHSRASLQVLGTVGEPINPEAWLWYHRVVGAQRCPIVDTFWQTETGGHMLTPLPG
AIPMKPGSATFPFFGVAPAILNESGEELEGEAEGYLVFKQPWPGIMRTVYGNHERFETTY
FKKFPGYYVTGDGCRRDKDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHKAVAEAAVV
GHPHPVKGECLYCFVTLCDGHIFSPALTEELKKQIREKIGPIATPDYIQNAPGLPKTRSG
KIMRRVLRKIAQNDHDLGDTSTVVDPSIITQLFSHRCLTIQ
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgggacttcccgaagagcggagccggagcggcagcgggagcggggcccgggaggaagct
ggagcccggagcccgacacggagctggtctccgccgcctgaggtcagccgttcggcgcac
gtcccctcgctgcagcgctaccgcgagctgcaccggcgctccttggaggagccgagagag
ttttggggagacattgccaaggaattttactggaagaccccatgtcctggtccattcctt
cagtacaactttgatgtgactaaagggaaaatcttcattgaatggatgaaaggagcaact
accaacatctgctacaacgtactggatcgaattgtccatgagaaaaaacttggcgataaa
gttgctttttactgggagggcaatgagccagaggaaaccacccagatcacataccgagag
cttctggtccaagtgtgtcggttcagcaatgttctccgaaaacagggcatttgcaagggt
gaccgagtggccatctacatgcccatgatcccggagctcgtggtggctatgctggcgtgt
gcccgccttggggctctgcactccattgtgtttgcggggttctcttcagagtctctttgt
gaacggatcctggattccaattgtagccttctcatcactacagatgccttctacaggggg
gaaaagcttgtcaacctgaaggagctggctgacgaggccctggagaagtgtcaggagaag
ggtttcccagtgaaatgctgcattgtggtcaagcacctggggcgggcagagctggtcaca
ggtgactctcctagccaatctcctccgattaagaggccatgcccggatgtgcagatctcc
tggaatgagggggttgacttgtggtggcatgaactcatgcagaaggcaggggatgagtgt
gagcctgaatggtgtgatgctgaagacccactcttcatcctgtacaccagtggctccaca
ggcaaacccaagggcgtgttacacacagttgggggctacatgctctatgtggccacaacc
ttcaagtatgtgtttgactttcatgcggaggatgtgttctggtgcaccgcagacattggc
tggatcactggccattcctatgtcacctatgggccactggccaatggtgccaccagtgtt
ttgtttgaggggattcccacatacccggatgtcagccgcctatggaatatcgtggagaag
tacaaggtgaccaagttctacacagcacctacagccatccgtctgctcatgaagtttgga
gatgagcctgttaccaagcacagccgggcgtccttacaggtgctaggaactgtgggcgaa
cctatcaaccctgaggcctggctctggtaccaccgggtggtaggtgcacagcgctgcccc
attgtggacaccttctggcagacagagacaggtggccatatgctgaccccgctccctggg
gccatacccatgaagcctggttctgctaccttcccattcttcggggtagctcctgcgatc
ctgaatgagtctggggaagagttagaaggtgaagctgaaggctatctggtgttcaagcag
ccttggccagggatcatgcgcacggtctatgggaaccacgaacgctttgagaccacctac
tttaagaagttccccgggtactatgtgacaggagatggctgccggcgggacaaggatggc
tattactggatcactggcaggatcgatgacatgctgaacgtatctggacacctgctgagc
acggcagaggtggagtcagcactcgtggaacacaaggctgttgcagaggcagccgtggtt
ggacaccctcatcctgtgaagggcgaatgcctctactgctttgtcaccttgtgcgatggc
cacatcttcagcccagctctcactgaggagctcaagaagcagattagagaaaagattggc
cccattgccaccccggattacatccagaatgcacctggattgcctaaaactcgctcaggg
aaaatcatgaggcgggtgcttcggaagatcgctcagaatgaccacgacctgggggacacg
tccactgtagtcgacccatccatcatcacccagctcttcagccaccgctgcttgaccatc
caatga

DBGET integrated database retrieval system