KEGG   Bos taurus (cow): 506544Help
Entry
506544            CDS       T01008                                 

Gene name
PFKM, ATP-PFK, PFK-M
Definition
phosphofructokinase, muscle (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bta  Bos taurus (cow)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
AMPK signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    506544 (PFKM)
   01230 Biosynthesis of amino acids
    506544 (PFKM)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    506544 (PFKM)
   00030 Pentose phosphate pathway
    506544 (PFKM)
   00051 Fructose and mannose metabolism
    506544 (PFKM)
   00052 Galactose metabolism
    506544 (PFKM)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    506544 (PFKM)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     506544 (PFKM)
Protein phosphatases and associated proteins [BR:bta01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     506544 (PFKM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 779 aa AA seqDB search
MTHEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIYTGARVFFVHEGYQGLVDG
GDNIREATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAHNLVKRGITNLCVIGGDGS
LTGADTFRSEWSDLLSDLQKSGKITAEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDSA
LHRIIEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWEE
HLCRRLSETRNRGSRLNIIIVAEGAIDKNGKPITSEDIKNLVVKRLGYDTRVTVLGHVQR
GGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTRA
MDERRFDEALKLRGRSFMNNWEVYKLLAHVRPPKSKSGSHTVAVMNVGAPAAGMNAAVRS
TVRIGLIQGNRMLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKSFEQI
SANITKFNIQGLVIIGGFEAYTGGLELMEGRKQYDELCIPFVVIPATVSNNVPGSDFSVG
ADTALNTICMTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEDPFT
IRDLQVNVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNVLGH
MQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANSPDSGCVLGMRKRALVFQ
PVTELKEQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSEHAHLEHISRKRSGEANV
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atgacccatgagcaccatgcagccaaaaccctgggaatcggcaaagccatcgccgtgtta
acctctggtggcgatgcccaaggtatgaatgctgctgtcagggctgtggttcgtgttggc
atctatactggtgcccgtgtcttctttgtccatgagggttatcaaggcctggtagatggt
ggagataacatccgggaagccacatgggagagtgtctcgatgatgcttcagctgggaggc
acggtgattggaagcgcccggtgcaaggactttcgggaacgggaaggccggctccgagct
gcccacaacctggtgaaacgtgggatcaccaacctgtgtgtcattgggggagacggcagc
ctgactggggccgacaccttccgctctgagtggagtgacttgttgagtgacctccagaaa
tcaggcaagattacagcagaggaggctaccaagtccagctacctgaacatcgtggggctg
gttggctcaattgacaatgacttctgtggcactgatatgaccattggcaccgactctgcc
ctgcaccggatcatagagattgtagatgccatcactactaccgctcagagccaccagagg
acctttgtgttggaggtgatgggccggcactgtggatacctggcccttgtcacttccctc
tcctgtggggccgactgggtctttattcccgagtgtccaccagatgacgactgggaggaa
cacctttgtcgccggctcagcgagacaaggaaccgtggttctcgtctcaacatcatcatc
gtagctgagggtgcgattgacaagaatgggaaaccaatcacctctgaagacatcaaaaac
ctggtggttaagcgtctgggatatgacacccgagtcaccgtcttggggcacgtgcagcgg
ggtgggacaccgtcggcctttgacagaatcctgggcagcaggatgggtgtggaagcagta
atggcacttttggaggggaccccggacaccccagcctgtgtggtgagcctctctggtaac
caggctgtgcgcctgcccctcatggagtgtgtccaggtgaccaaggacgtgaccagggcc
atggatgaaaggagattcgatgaggccttgaagctgaggggccggagcttcatgaacaac
tgggaggtatacaagcttctggctcacgtcagacccccaaagtctaagagtggctcccac
acggtggccgtgatgaacgtgggagcgccggccgcaggcatgaacgcagccgttcgctcc
actgtgagaatcggcctcatccagggcaaccgaatgctggtggtgcacgatggcttcgag
ggcctggccaagggtcagatcgaggaagctggatggagctacgtcgggggctggactggc
caaggtggttctaaacttgggactaaaaggactctacccaagaagagctttgaacagatc
agtgccaacatcacgaagtttaatattcagggccttgtcattatcgggggctttgaggct
tacacggggggcctggagctgatggaaggcaggaagcagtatgatgagctctgcatcccc
ttcgtggtcatccctgccacggtctccaacaatgtgcccggctcggacttcagcgtgggg
gctgacactgccctcaacaccatctgcatgacgtgtgaccgcatcaagcagtcagcggca
ggcaccaagcgccgtgtgtttatcattgaaacgatgggcggctactgtggctacctggcc
accatggcaggcctggcagctggggctgatgctgcgtatatttttgaggaccccttcacc
attcgagacctgcaggtgaatgtggagcatctggtgcagaagatgaaaacgactgtgaag
aggggcctggtgttaaggaacgagaagtgcaatgagaactacaccactgacttcatcttc
aacttgtactctgaggaggggaagggcatcttcgacagcaggaagaacgtgctgggccac
atgcagcagggtgggagcccaactccattcgacaggaattttgccactaagatgggtgca
aaggctatgaactggatgtcagggaaaatcaaagagagttaccgtaatgggcggatcttt
gccaattccccagactcgggctgtgttctggggatgcgtaagagggccctggtcttccaa
ccagtgactgagttgaaggaacagacggattttgagcaccgcatccccaaggagcagtgg
tggctgaagctgaggcccatcctcaagatcctcgccaagtacgagattgacttggatacc
tcagagcacgcccacctggagcacatctctcggaagcggtccggagaagctaacgtctag

DBGET integrated database retrieval system