KEGG   Bos taurus (cow): 506888Help
Entry
506888            CDS       T01008                                 

Gene name
DLST
Definition
dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bta  Bos taurus (cow)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    506888 (DLST)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    506888 (DLST)
  Amino acid metabolism
   00310 Lysine degradation
    506888 (DLST)
Enzymes [BR:bta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     506888 (DLST)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
10
AA seq 455 aa AA seqDB search
MLSRSRCASRAFSRSLSAFQKGNCPLVRRSLPGISLCQGPGYPDSRKTVINSSNIFSVRF
FRTTAVCKDDVITVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPA
NGVIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAAAPAAAAPKAEPTVSAVPPPPAA
PIPTQMPPVPSPSQPLTSKPVSAVKPTAAPPRAEAGAGVGLRSEHREKMNRMRQRIAQRL
KEAQNTCAMLTTFNEIDMSNIQEMRARHKDAFLKKHNLKLGFMSAFVKASAFALQEQPVV
NAVIDDATKEVVYRDYIDISVAVATPRGLVVPVIRNVETMNYADIERTISELGEKARKNE
LAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHAIVDRPVVIGGKVEVRPMMYV
ALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcccggtcccgctgcgcgtcccgggcgttcagccgctcgctgtccgccttccag
aaggggaactgccctctagtgagacgttccctgcctgggatctccttatgtcagggacca
ggttaccctgacagcaggaagactgtcattaacagcagtaatatcttcagcgttcgcttc
tttagaactacagctgtgtgcaaggatgatgtgattacagtcaaaaccccagcatttgca
gaatctgtcacagagggggatgtcaggtgggagaaagctgttggagacacagttgcagaa
gatgaagtggtttgtgagattgaaactgacaagacctctgtgcaggttccgtcaccagca
aatggcgtgattgaagctcttttggtacctgatgggggaaaagtagaaggaggcactcct
cttttcacactcaggaaaactggcgctgctcctgctaaggccaagccagctgcagcccct
gctgccgcagccccaaaagcagaacccacagtgtctgctgttcctcctccccctgcagca
cctatacccacccagatgccacctgtgccctcgccctcacagccgctcactagcaaacca
gtgtctgctgtaaaacccaccgctgcccctccaagagctgaggcaggagctggtgtaggt
ctgcgttcagaacatcgggagaagatgaacaggatgcggcaacgcatcgcccagcgtctg
aaggaggctcagaacacctgcgcgatgctcaccactttcaatgagattgacatgagtaat
atccaggagatgcgggctcggcacaaagatgcttttctgaagaaacataacctcaaacta
ggcttcatgtcagcatttgtgaaggcctcagcctttgccttgcaggagcagcctgtggta
aatgcagtgattgacgatgcaaccaaagaggtggtgtatagggattatattgacatcagc
gttgcggtggccacccctcggggtctggttgttcccgtcatcaggaatgtggaaacaatg
aattatgccgatattgagcgaaccatcagtgaactgggagagaaggcccggaagaatgaa
cttgccattgaagatatggatggtggtacttttaccatcagcaatggaggtgtttttggc
tcgctctttggaacacccatcatcaacccccctcagtctgccatcctgggcatgcatgcc
atcgttgataggccagtggtcataggaggcaaggtggaggtgcggcccatgatgtacgtg
gccctgacgtatgatcaccggctgatcgatggcagagaggctgtgactttcctccgcaaa
attaaggcagcggtagaggatcccagagtcctcctactggacctttag

DBGET integrated database retrieval system