KEGG   Bos taurus (cow): 506996Help
Entry
506996            CDS       T01008                                 

Gene name
USP43
Definition
ubiquitin specific peptidase 43
Orthology
K11856  
ubiquitin carboxyl-terminal hydrolase 43 [EC:3.4.19.12]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     506996 (USP43)
Peptidases [BR:bta01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   506996 (USP43)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
19
AA seq 1121 aa AA seqDB search
MDPSAGAAAEEEPPAPRPRRRRSLRRLFGRFLLALGSRSRLGDSPPRPRPQPQSGHGDGD
GEGGFEGKDPAAPGSPGEERPPGPQPQLPAGDAARPPGAQGLKNHGNTCFMNAVVQCLSN
TDLLAEFLALRRYRAEPGRAEVTEQLAALVRALWTREYTPQLSAEFKNAVSKYGAQFQGN
AQHDALEFLLWLLDRVHEDLEGSSRGPGSDKLQPEARKTSENLLSPSAPLSMGQSFVQSH
FQAQYRSSLTCPHCLKQSNTFDPFLCVSLPIPLRQTRFLSVTLVFPSKSQRFLRIGLAVP
ILSTVAALRKMVAEEGGVSPEEVILVELYPSGLQRSFFDEEDLNTIAEGDNVYAFQAPPS
PGQEMLSARPSGLLVSPCLAAREGQRLSLPVHNETSVLILFCNLVGSGQQASRFGPPFLV
REDRAISWIQLQQCILSKVRYLMKSEVPIQNLGSLFSIRVVGLSLACSYLSPQDSRPLCH
WAVDRALHLRRPGGPPHIKLAVEWDVDTKERLFGSPQEERVQDADSVRRQQQAHQQHSCT
LDECFQFYTKEEQLAQDDAWRCPHCQALQQGVVKLSLWTLPDILIIHLKRFCQVGERRNK
LSTLVKFPLAGLNMAPHVAQRSTSPKAMPGAWPPSWKQPACLPTSYPPDFLYDLYAVCNH
HGSLQGGHYTAYCRNSLDGQWYSYDDSMVEPLLEDEVNTRGAYILFYQKRNSIPPWSASS
SMRGSTSSSLSDHWLLRLGSSNGSTRGSLLSWSSAPGPARPRLPESAFCTNSLPRQEKGG
LESRPLARGIQGRSISMKVPTPSRAKQGAFKTMPLRWSFGPREKPLGTSVELVEYLESRR
RPRSTSQSIVQLLTGPAGGHQKSHATLSAESEDSRRTSDTVLATAPCPSGHPGHCVVPGN
SDGLNAARKLKENSSQDIRLPKQFDLPLTVMSSTEDDGRRARPEGQRTTSCKGSGLTGSS
GQAPSPKEGPSAAAANGERRDPETDRFPQGTLTLLRSVFWKKEIRKRDRPEAAPQVAPVS
LVSGRRSPAVDGEARSSSPSLRIRESLARGPAGHLERERDIRSAPSSLVLPRKTGRPPRA
NALGMSQRSVPGEQTSFGTLPKVKYHTLSLRRKKSLPESSF
NT seq 3366 nt NT seq  +upstreamnt  +downstreamnt
atggacccaagcgcgggggccgcggccgaagaggagccgcctgcgccccggccccgccgc
cgccgctccctgcgccgcctgttcggccgcttcctgctggcgctgggcagtcgctcccgc
cttggggactcgccgccccggccccgaccccagccccagtcaggacacggcgatggcgat
ggggaggggggctttgagggcaaggatcccgccgcgcccggaagccccggggaggagcgc
ccgcccggaccccagccccagctccccgccggcgacgcggcgcggcccccaggagcgcag
ggcttgaagaaccacggcaacacctgtttcatgaatgccgtggtgcagtgtctgagcaac
accgacctgctggccgagttcctggcgctgaggcgctaccgggcggagcccggccgcgcc
gaggtcaccgagcagctggcggcgctggtgcgcgcgctctggactcgcgaatacacgccc
caactttccgcggagttcaagaacgcagtctccaagtatggcgctcagttccaaggcaat
gcccagcacgatgccctggagttcctgctctggttgttggatcgcgtgcacgaggacttg
gagggctcctcccgagggccgggttctgacaagcttcaacctgaagccaggaagacctct
gagaaccttctgtcgccatcggctccgctttctatgggccaaagctttgtgcaaagccac
ttccaagcacaatacagatcttccttgacctgtccccactgcctgaaacagagcaacacc
ttcgaccctttcctgtgcgtgtccctgcccatccctctgcgccagacgagattcttgagt
gtcaccttggtcttcccctccaagagccagcggttcctgcgcattggcttggccgtgcca
atcctgagcacagtggcagccctgaggaagatggttgcagaggaaggcggtgtctctcca
gaggaggtgatcttggttgaactgtatcccagtggactccagcggtctttctttgacgaa
gaggacctgaatactattgcagaaggagataatgtctatgccttccaagctcccccatca
cctgggcaggagatgctctcagctcgtccatctggtctacttgtctccccgtgcttggca
gcccgtgagggtcagcgattatcgctgcccgtccacaacgagacctcggtgctaatcctc
ttctgtaatctggtgggctctgggcagcaggccagcaggtttgggcctcctttcttggta
agggaagacagagccatctcatggatccagctccagcagtgcattcttagcaaagtccga
tacctcatgaagagcgaagtccccatacagaacctggggtcactgttctccatccgggtc
gtgggactctcactggcctgtagctacttgtccccacaggacagtcggcccctctgtcac
tgggcagttgacagggctctgcatctcaggaggccaggaggccctccgcacatcaaactg
gctgtggagtgggacgttgacaccaaggagcgcctgtttgggagcccccaggaggagcgg
gtgcaagatgcagacagtgtgaggcggcagcagcaggctcaccagcaacacagctgcacc
ctggacgagtgtttccagttctacaccaaggaggagcagctggcccaggacgacgcatgg
cgttgcccccactgccaggccctgcagcagggcgtggtgaagctgagcctctggaccctg
cctgacatccttatcatccacctcaagcgcttctgccaggtgggcgagaggaggaacaag
ctctccacgctggtgaagttcccgctcgccgggctcaacatggctccccacgtggcccag
aggagcaccagccccaaggccatgccgggcgcctggcctccttcctggaagcagccagcc
tgcctgcccaccagctacccgccagacttcctgtacgacctctacgccgtctgcaaccac
cacggcagtttgcaaggtgggcattacacagcctactgccggaactctctggacggccag
tggtacagttacgatgacagcatggtggagccgcttctagaagacgaggtcaatacacga
ggggcttacatcttgttttatcagaagaggaacagcatccctccatggtcagccagcagc
tccatgagaggttccaccagctcctccttgtctgaccactggctcctcaggctcgggagc
agtaacggcagtacaaggggcagcctgttgtcctggagctctgcccctggccctgcgcgg
ccccggttgcccgagtctgccttctgcaccaacagcctgcccaggcaggagaagggaggc
ttggagtccaggcctttggcacggggcatccaaggccgcagcatcagcatgaaggtgcct
acgccttcccgagcaaagcagggggccttcaagaccatgcccctccgctggtcttttggc
cccagggagaaaccgctgggcacatctgtcgagctggtggagtacctggagtccagacgg
agacctcggtccacgagccagtccatcgtgcagctgctgacgggtcctgccggcggtcac
cagaagtcacacgccaccctctctgcggagagtgaagacagtaggcgaaccagtgacaca
gtgctggccacagcgccctgcccctctggccatcctggccactgcgtggtccctggcaac
tcagatggcctgaatgcagccaggaagctcaaggaaaactcaagtcaggacatcaggctg
cccaaacagtttgacttgcccctcacagtgatgtcctcaacagaagatgatgggagacga
gcccggcctgagggccaaaggaccacaagctgtaagggaagtggcctaaccgggagcagt
ggccaagcaccctcccccaaggagggtcccagcgctgcggcggctaatggggagagaagg
gaccctgagacagacagattcccacaagggaccctcacccttctgaggtctgtgttttgg
aagaaggagatcaggaagagggacaggccagaggcagccccccaggtggcccccgtctcc
ctggtgagcggcaggaggagcccagctgtggatggggaggcccgaagctcatctccatcc
ctcaggattcgagagagcctggccaggggcccggccggccacctggaaagagagagggac
atccgatcagcgcccagctctctggtcctccctcgcaagactggcaggcccccgagggcc
aacgccctcggcatgtcacagaggagtgtccctggggagcagacgtcttttggcaccttg
ccgaaggtgaagtaccacacactgtccttacgtcgaaagaaatccttgcctgagtccagc
ttctga

DBGET integrated database retrieval system