KEGG   Bos taurus (cow): 507119Help
Entry
507119            CDS       T01008                                 

Gene name
PFKP
Definition
phosphofructokinase, platelet (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bta  Bos taurus (cow)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
AMPK signaling pathway
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    507119 (PFKP)
   01230 Biosynthesis of amino acids
    507119 (PFKP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    507119 (PFKP)
   00030 Pentose phosphate pathway
    507119 (PFKP)
   00051 Fructose and mannose metabolism
    507119 (PFKP)
   00052 Galactose metabolism
    507119 (PFKP)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    507119 (PFKP)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    507119 (PFKP)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    507119 (PFKP)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     507119 (PFKP)
Protein phosphatases and associated proteins [BR:bta01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     507119 (PFKP)
Messenger RNA biogenesis [BR:bta03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     507119 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
Position
13
AA seq 791 aa AA seqDB search
MDSHDSPQTPKGSLRKFLEQLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYF
IYEGYQGMVDGGSNIVEADWESVSSILQVGGTIIGSARCQDFRTREGRLKAACNLVQLGI
TSLCVIGGDGSLTGAHIFQTEWSGLLEELARDGKISTEQVQKHGHLNVVGMVGSIDNDFC
GTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFL
PESPPEEGWQENMCIKLSENRAWKKRLNIIIVAEGAIDTQNKPITSEQIKELVVTQLGYD
TRVTILGHVQRGGTPSAFDRILASRMGVEAVVALLQATPETPACVVSLSGNQAVRLPLME
CVQMTQEVQKAMDERRFKDAVRLRGRSFENNLNTYKRLAIKLPDSEIPKSNCNVGVVNVG
APAAGMNAAVRAAVRVGISEGHKMFAVYDGFEGFAKGQIKEIGWGDVGGWTGQGGSILGT
KRTLPGKYLEDIAAQMRTHGISALLIIGGFEAYLGLLELLAARQKHEEFCVPMVMVPATV
SNNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGFCGYLANMGGLAAG
ADAAYIFEEPFDIRDLQSNVEHLTEKMKTSIQRGLVLRNESCSENYTTDFIYQLYSEEGK
GVFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMQWISSKLRESVGKGKKFLSEDSVCV
LGISKRTLLFQPVAELKKETDFEHRIPKEQWWLKLRPLMKILAKYKVSFEVSDASQLEPV
QPRGPEEPAAI
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atggacagccacgacagcccccagacccccaagggctccctccgaaaattcctggagcaa
ctctccggggccggcaaagccatcggcgtgctgaccagcggcggggatgcccaaggcatg
aatgctgctgtccgggccgtcgtgcgcatggggatatacgtgggggccaaggtgtacttc
atctatgagggctaccagggcatggtggacggtggcagcaacattgtggaagccgactgg
gagagcgtgtccagcatcctgcaagtgggagggaccatcattggcagtgcccgctgccag
gacttccgtactcgggaaggccgcctgaaggccgcatgtaacttggttcagctgggcatc
accagcctgtgtgtgatcggcggggacggcagtctcaccggggcccacatcttccagacg
gagtggagcgggctgctggaggagctggcccgcgacggcaagatcagcacggagcaggta
cagaagcacgggcacctcaacgtggtgggaatggtgggctccatcgacaatgacttctgc
ggcacggacatgaccatcggcacggactcggccctacaccgcatcatcgaggtggtggac
gccatcatgacgaccgcccagagccaccagcggaccttcgtcctggaggtgatggggaga
cactgcgggtacctggccctggtgagtgctctggcttgtggggccgactgggtcttcctt
cccgagtccccacctgaggaaggctggcaggaaaacatgtgcatcaagctctcagagaac
cgtgcctggaagaaaaggttgaacatcatcattgtggccgaaggggccatcgacacccag
aacaagcccatcacctcggagcagatcaaggagcttgtggtcacgcagctgggctacgac
acgcgagtgaccatccttggacacgtgcagagaggtgggacgccatcagcctttgacagg
attctggccagccgcatgggggtggaggccgtggtcgccctcctgcaggccactcccgag
accccggcttgcgtggtgtcactgagtgggaaccaggcagtgcggctgccgctgatggag
tgtgtacagatgacccaggaggtacaaaaagcgatggatgagaggagatttaaggatgcc
gtgcgactccgaggaaggagcttcgagaacaacctcaatacctacaagcggctggccatc
aagctgccggactccgaaatcccaaagagcaactgcaatgtgggcgtcgtgaacgtgggt
gcgcccgcggccggcatgaacgcggccgtgcgtgctgccgtgcgcgtgggcatctctgag
ggacacaagatgtttgccgtgtacgacggcttcgagggcttcgccaaaggccagataaag
gaaattggctggggggacgttggaggctggacgggccaaggcggctccatccttgggaca
aaacgcaccctccctgggaagtacctggaggacatcgcggcgcagatgcgaacccatggc
atcagtgcgctcttgatcatcggtggattcgaggcctacctggggctgctggagctgttg
gccgcccggcagaagcacgaggagttctgtgtccccatggtcatggtccccgccaccgtc
tccaacaacgtgcccggctccgacttcagcatcggggcggatactgccctcaacaccatc
accgatacgtgtgaccgcatcaagcagtcagccagcgggaccaagcggcgcgtgttcatc
attgagaccatggggggcttctgtggctacctggccaacatgggaggactggcggctggc
gcagacgctgcctacatcttcgaggagcccttcgacatccgggacctgcagtccaacgtg
gagcacctgacggagaagatgaagaccagcatccagagggggctggtgctcaggaacgag
agctgcagcgagaactacaccaccgacttcatctaccagctctactccgaggagggcaag
ggcgtgttcgactgcaggaagaatgtgctgggccacatgcagcagggtggggcgccttct
ccgttcgacagaaactttggaaccaaaatttccgccagagccatgcagtggatcagctcg
aagctgagggagtccgtggggaaaggaaaaaaatttttaagtgaggactctgtgtgtgtg
ctgggaatcagcaagagaacactgctgttccagcccgtggcggagctgaagaaggagaca
gacttcgagcaccggatccccaaggagcagtggtggttgaagctgcggcccctcatgaag
atcctggccaagtacaaggtcagcttcgaggtgtcggatgccagccagctggagcctgtg
cagccccgtggccccgaggagccggctgccatctag

DBGET integrated database retrieval system