KEGG   Bos taurus (cow): 507188Help
Entry
507188            CDS       T01008                                 

Gene name
GLB1
Definition
galactosidase, beta 1 (EC:3.2.1.23)
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
bta  Bos taurus (cow)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Module
Keratan sulfate degradation
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bta00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bta00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:bta00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:bta00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:bta00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:bta04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
22
AA seq 653 aa AA seqDB search
MPGVVRLLALLLVPLLLGSARGLHNATQRTFQIDYRRNRFLKDGQPFRYISGSIHYFRVP
RFYWKDRLLKMKMAGLNAIQTYVAWNFHELQPGRYNFSGDHDVEHFIQLAHELGLLVILR
PGPYICAEWDMGGLPAWLLEKKSIVLRSSDPDYLAAVDKWLGVLLPKMRPLLYKNGGPII
TVQVENEYGSYLSCDYDYLRFLQKRFHDHLGEDVLLFTTDGVNERLLQCGALQGLYATVD
FSPGTNLTAAFMLQRKFEPTGPLVNSEFYTGWLDHWGQRHSTVSSKAVAFTLHDMLALGA
NVNMYMFIGGTNFAYWNGANIPYQPQPTSYDYDAPLSEAGDLTEKYFALRDIIQKFAKVP
EGPIPPSTPKFAYGKVALNKLKTVEDALNILCPSGPIKSVYPLTFIDVKQYFGFVLYRTM
LPEDCSDPTPLSSPLSGVHDRAYVSVNGVAQGILERESVITLNITGKAGATLDLLVENMG
RVNYGSSINDFKGLVSNLTLGSKILTNWEIFPLDMEDAVRSHLGTWGGRDRGYHNKARAH
SPPTYALPTFYVGNFTIPSGIADLPQDTFIQFPGWTKGQVWINGFNLGRYWPVRGPQMTL
FVPQHILVTSTPNTIVVLELEHAPCQDGGPELCTVEFVDKPVFRTVQTHRHAN
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgccgggggtcgttcgcctcctcgctctgctgctggtgccgctgctgctgggctctgcg
cgtggtttgcacaacgccacccagagaacattccagatcgactaccgccgtaaccgcttc
ctcaaggatggccagcccttccgctacatctcgggaagcattcactatttccgtgtgccc
cgcttctactggaaggaccggctgctgaagatgaagatggctgggctgaacgccatccag
acgtacgtggcctggaacttccatgagctgcagcctggacggtacaatttctccggggac
catgatgtggaacatttcattcagctggcacatgagctgggactgctggtcatcctgagg
cctggaccctacatctgtgcagagtgggacatgggaggattacctgcttggctattggag
aaaaaatctattgttctccgttcttcggatccagattaccttgcggctgtggacaagtgg
ctgggggtccttctgcccaagatgagacccctcctctataagaatggaggcccgattata
acagtgcaggttgaaaatgaatatggcagctacctctcctgtgattacgactacttgcgt
ttcctgcagaagcgtttccacgaccacctgggtgaggatgtgcttctgttcaccacggac
ggggtgaatgagaggttgctgcagtgtggggcgctccaggggctctacgccaccgtggac
ttcagcccaggtaccaacctcaccgctgctttcatgctccagaggaaatttgaacccaca
ggacccctggtcaattctgaattctacactggatggttagatcactggggccagcgtcat
tccacagtcagctccaaagcagtggctttcacccttcatgatatgcttgctctcggggca
aatgtaaacatgtacatgtttataggtggcaccaattttgcctattggaatggagccaac
ataccctaccaaccacagcccaccagctacgactatgatgcccccctgagcgaggccggg
gacctcactgagaagtattttgctctgcgggatattattcagaagtttgcaaaagtacca
gaaggtcctatccccccatccacaccgaagtttgcatatggaaaagttgctctgaataag
ttaaagacagtggaggatgctctcaacatcctgtgtccctctggacccataaaaagtgtt
tatcccttgacatttatcgatgtgaaacagtactttggatttgtgctgtaccgaacaatg
ctccctgaagactgcagcgaccctacacccctctcttcaccactcagtggtgtccatgac
cgggcctacgtctctgtgaacggggttgcccagggaatccttgaacgagaatctgtgatc
accctgaacataacagggaaagctggagccaccttggacctcctggtggagaatatgggg
cgtgtgaactatggctcgtctatcaatgattttaagggtcttgtttctaacctgaccctt
ggttccaaaatccttaccaactgggagatcttcccgctggacatggaggatgcagtacgc
agtcacctggggacctggggtggccgtgaccggggctaccacaataaagcccgtgcacac
agcccccctacctacgcactcccgaccttttatgtgggtaacttcactattcccagcggg
atcgcagacttgcctcaggacacctttatccagtttcctggatggaccaagggtcaggtg
tggatcaacggctttaacctcggccgctactggccagtgcggggcccccagatgaccctg
ttcgtgcctcagcacatcctggtgacctcgaccccaaacaccatcgtggtgctagagctg
gagcatgcgccctgccaggacggcggcccggaactgtgcaccgtggagttcgtggacaag
ccggtttttcgcacagtccagacccacagacatgcaaactag

DBGET integrated database retrieval system