KEGG   Bos taurus (cow): 507307Help
Entry
507307            CDS       T01008                                 

Gene name
USP9X
Definition
ubiquitin specific peptidase 9, X-linked
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.4.19.12]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     507307 (USP9X)
Peptidases [BR:bta01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   507307 (USP9X)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
X
AA seq 2570 aa AA seqDB search
MTATTRGSPVGGNDSQGQAPDGQSQPALQQNQTSSPDSSNENSPATPPDEQGQGDAPSQL
EDEEPAFPHTDLAKLDDMINRPRWVVPVLPKGELEVLLEAAIDLSKKGLDVKSEACQRFF
RDGLTISFTKILTDEAVSGWKFEIHRCIINNTHRLVELCVAKLSQDWFPLLELLSMALNP
HCKFHIYNGTRPCESVSSNVQLPEDELFARSPDPRSPKGWLVDLLNKFGTLNGFQILHDR
FINGSALNVQIIAALIKPFGQCYEFLTLHTVKKYFLPVIEMVPQFLENLTDEELKKEAKN
EAKNDALSMIIKSLKNLASRVPGQEETVKNLEIFRLKMILRLLQISSFNGKMNALNEVNK
VISSVSYYTHRHGNPEEEEWLTAERMAEWIQQNNILSIVLRDSLHQPQYVEKLEKILRFV
IKEKALTLQDLDNIWAAQAGKHEAIVKNVHDLLAKLAWDFSPEQLDHLFDCFKASWTNAS
KKQREKLLELIRRLAEDDKDGVMAHKVLNLLWNLAHSDDVPVDIMDLALSAHIKILDYSC
SQDRDTQKIQWIDRFIEELRTNDKWVIPALKQIREICSLFGEAPQNLSQTQRSPHVFYRH
DLINQLQHNHALVTLVAENLATYMESMRLYARDHEDYDPQTVRLGSRYSHVQEVQERLNF
LRFLLKDGQLWLCAPQAKQIWKCLAENAVYLCDREACFKWYSKLMGDEPDLDPDINKDFF
ESNVLQLDPSLLTENGMKCFERFFKAVNCREGKLVAKRRAYMMDDLELIGLDYLWRVVIQ
SNDDIASRAIDLLKEIYTNLGPRLQVNQVVIHEDFIQSCFDRLKASYDTLCVLDGDKDSI
NCARQEAVRMVRVLTVLREYINECDSDYHEERTILPMSRAFRGKHLSFIVRFPNQGRQVD
DLDVWSHTNDTIGSVRRCILNRIKANVAHTKIELFVGGELIDPADDRKLIGQLNLKDKSL
ITAKLTQISSNMPSSPDSSSDSSTGSPGNHGNHYSDGPNPEVESCLPGVIMSLNPRYISF
LWQVADLGSSLNMPPLRDGARVLMKLMPPDSTTIEKLRAICLDHAKLGDSSLSPSLDSLF
FGPSASQVLYLTEVVYALLMPAGALLADDSSDFQFHFLKSGGLPLVLSMLTRNNFLPNAD
METRRGAYLNALKIAKLLLTAIGYGHVRAVAEACQPGVEGVNPMASVNQVTHDQAVVLQS
ALQSIPNPSSECMLRNVSIRLAQQISDEASRYMPDICVIRAIQKIIWASGCGALQLVFSP
NEEITKIYEKTNAGNEPDLEDEQVCCEAMEVMTLCFALIPTALDTLSKEKAWQTFIIDLL
LHCHSKTVRQVAQEQFFLMCTRCCMGHRPLLFFITLLFTVLGSTARERAKHSGDYFTLLR
HLLNYAYNSNINIPNAEVLLNNEIDWLKRIRDDVKRTGETGIEETILEGHLGVTKELLAF
QTPEKKYHIGCEKGGANLIKELIDDFIFPASNVYLQYMRNGELPAEQAIPVCGSPATINA
GFELLVALAVGCVRNLKQIVDSLTEMYYIGTAITTCEALTEWEYLPPVGPRPPKGFVGLK
NAGATCYMNSVIQQLYMIPSIRNGILAIEGTGSDVDDDLSGDEKQDNESNVDPRDDVFGY
PQQFEDKPALSKTEDRKEYNIGVLRHLQVIFGHLAASRLQYYVPRGFWKQFRLWGEPVNL
REQHDALEFFNSLVDSLDEALKALGHPAMLSKVLGGSFADQKICQGCPHRYECEESFTTL
NVDIRNHQNLLDSLEQYVKGDLLEGANAYHCEKCNKKVDTVKRLLIKKLPPVLAIQLKRF
DYDWERECAIKFNDYFEFPRELDMEPYTVAGVAKLEGDNVNPESQLIQQNEQSDSETAGS
TKYRLVGVLVHSGQASGGHYYSYIIQRNGGDGERNRWYKFDDGDVTECKMDDDEEMKNQC
FGGEYMGEVFDHMMKRMSYRRQKRWWNAYILFYERLDTIDQGDELIRYISELAITARPHQ
IIMPSAIERSVRKQNVQFMHNRMQYSMEYFQFMKKLLTCNGVYLNPPPGQDHLLPEAEEI
TMISIQLAARFLFTTGFHTKKIVRGSASDWYDALCILLRHSKNVRFWFAHNVLFNVSNRF
SEYLLECPSAEVRGAFAKLIVFIAHFSLQDGPCPSPFASPGPSSQAYDNLSLSDHLLRAV
LNLLRREVSEHGRHLQQYFNLFVMYANLGVAEKTQLLKLSVPATFMLVSLDEGPGPPIKY
QYAELGKLYSVVSQLIRCCNVSSRMQSSINGNPPLPNPFGDPNLSQPIMPIQQNVADILF
VRTSYVKKIIEDCSNSEETVKLLRFCCWENPQFSSTVLSELLWQVAYSYTYELRPYLDLL
LQILLIEDSWQTHRIHNALKGIPDDRDGLFDTIQRSKNHYQKRAYQCIKCMVALFSNCPV
AYQILQGNGDLKRKWTWAVEWLGDELERRPYTGNPQYTYNNWSPPVQSNETSNGYFLERS
HSARMTLAKACELCPEEVKKATSVQQIEMEESKEPDDQDAPDEHESPPPEDAPLYPHSPG
SQYQQNNHVHGQPYTGPAAHHMNNPQRTGQRAQENYEGSEEVSPPQTKDQ
NT seq 7713 nt NT seq  +upstreamnt  +downstreamnt
atgacagccacgactcgtggctctccagtaggagggaatgacagccagggccaggctcct
gatggacagtctcagcccgccctccaacagaatcagacctcatcgcctgattcctccaat
gaaaattccccggcaactcctccagatgagcaaggtcaaggtgatgccccatcacagctt
gaagatgaggagcctgcatttccacatactgacctggcaaagttggatgacatgatcaat
aggcctcgatgggtggttccagttttgccaaaaggggaattagaagtgcttttagaagct
gctattgaccttagtaaaaaaggccttgatgttaaaagtgaagcatgtcagcgatttttt
cgagatgggctaacaatatctttcacgaaaatccttacagacgaggcagtgagtggctgg
aagtttgagattcataggtgtattatcaacaatactcatcgcctggtggaactatgtgtg
gccaagttgtcccaagattggtttccacttctagaacttctctccatggccttaaatcct
cattgcaaattccatatctacaatggtacacgtccatgtgaatccgtttcctcaaatgtt
cagttgcctgaagatgaactctttgctcgttctccagaccctcgatcgccaaaaggttgg
ctagtggatcttctcaacaaattcggcactttaaatggattccagattttgcatgatcgt
tttattaatggatcagcattaaatgttcaaataattgcagcccttattaaaccatttgga
caatgctatgagtttctcactcttcatacggtgaaaaagtactttcttccagtaatagaa
atggttccacagtttttagaaaacttaactgatgaagaactgaaaaaagaagcaaagaat
gaagccaaaaatgatgctctttcaatgattattaaatctttgaaaaatttagcttcaaga
gttccaggacaagaagaaactgtaaaaaacttagaaatatttaggttaaaaatgatactt
agattattgcaaatttcttctttcaatggaaaaatgaatgcacttaatgaggttaataag
gtgatatctagtgtatcatactacacccatcggcatggtaaccctgaggaggaagaatgg
ctcacagctgaacgaatggcagaatggatacagcagaacaatattttgtccatagtcttg
cgagatagtcttcatcaaccacagtatgtggaaaagctagagaagattcttcgttttgtc
atcaaagaaaaagccctgaccttacaagatcttgataatatctgggcagcacaggcaggg
aagcatgaagccattgtgaagaatgtacatgatctactggcgaaattggcatgggatttt
tctcctgagcaacttgatcatctttttgattgctttaaggccagttggacaaatgcaagt
aaaaagcagcgagaaaagttacttgagctgatacgtcgtcttgcagaagatgacaaagat
ggtgtgatggcacacaaagtgttgaacctcctctggaatctggcccatagtgatgatgtg
cctgtagacatcatggacctggctctcagcgcccacataaaaatactagattatagttgt
tcccaggaccgtgacacacagaagatacagtggatagatcgctttatagaagagcttcgt
acaaatgacaaatgggtgattcctgcactgaaacaaattagagaaatttgtagtttgttt
ggtgaagcacctcagaatttgagtcaaactcagcgaagtccccatgtattctatcgccat
gacttaatcaatcaacttcagcacaatcatgccctagttactttggtagcagaaaacctt
gcaacttacatggaaagcatgaggctgtatgctagagaccatgaagactatgacccacaa
actgtgaggctgggaagtagatacagtcatgttcaagaagttcaagaacggcttaacttc
cttagatttttattaaaggatggccaactgtggctatgcgctcctcaggcaaaacaaata
tggaaatgcttagcagagaatgcagtttacctttgtgatcgtgaagcctgttttaagtgg
tattccaagttgatgggggatgaaccagacttggatcctgatattaataaggacttcttt
gaaagcaatgtacttcagcttgatccatccttgttgactgaaaatgggatgaaatgtttt
gaacgattcttcaaagctgtgaattgtcgggaaggaaaactggtagccaaaaggagagca
tatatgatggatgatttggaactaattggattagactacctttggagggtggtgattcag
agtaatgatgatattgccagcagagctatagatctccttaaagagatatacacaaacctt
ggtccaaggctacaggtcaatcaggtggtgatccatgaagacttcattcagtcttgcttt
gatcgtttgaaagcctcctatgacactttatgtgttttggatggtgacaaagacagtatt
aattgtgcgagacaggaagctgttcgaatggttcgagtattaactgtattaagggaatat
ataaatgaatgtgatagtgattatcatgaggaaagaacaattctgcctatgtcaagagct
ttccgtggtaaacatctctcttttatagttcgatttccaaaccaaggcagacaggttgat
gacttggatgtatggtctcatacaaatgatacaatcggttcagtacgacgatgtattctc
aatcgtatcaaagccaatgtagctcatacaaaaattgagctctttgtgggtggtgaactg
atagatcctgcagatgatagaaaattgatcggacaattaaacttaaaagataagtcgcta
attacagccaaacttacacagatcagttccaatatgccttcaagccctgatagctcttct
gattcctcaactgggtctcctggaaaccatggtaatcattacagtgatggtcccaatcca
gaagtggaaagctgtttgcctggggtgataatgtcactgaatcccagatacatctctttc
ctttggcaagtcgcagacttgggtagcagcttaaatatgccacctcttagagatggagca
agagtacttatgaaacttatgccaccagatagcacaacaatagaaaaattaagagctatt
tgtttagaccatgccaaacttggagacagcagccttagtccatctcttgactcacttttc
tttggtccttcagcctcacaagtactatacctaacagaggtagtctatgccttgttaatg
cctgctggtgcacttctggctgatgattcctctgattttcaatttcacttcttgaaaagt
ggtggcctcccccttgtcttgagcatgctaaccagaaataacttcttaccaaatgcagat
atggaaactcgaaggggtgcctacctcaatgctcttaaaatagccaagctgttgctaact
gccattggctatggtcacgttcgagccgtggcagaagcttgtcagccgggtgtggaaggc
gtgaatccgatggcatcggtcaaccaagtgactcatgatcaagcagtggtgctacaaagt
gcccttcagagcattcccaatccatcgtctgaatgcatgcttagaaatgtgtcaattcgt
cttgctcagcaaatatctgatgaggcttcaagatatatgcctgatatttgtgtaattaga
gctatccaaaaaatcatctgggcatcaggatgtggggcattacagctagtatttagccca
aatgaagaaatcactaaaatttatgagaagaccaatgcaggcaatgagccagatttggag
gatgaacaggtttgctgtgaagcaatggaagtgatgacattatgttttgccttgattcca
acagccttagatactcttagtaaagaaaaggcttggcagacattcattattgatttacta
ttgcactgtcacagcaaaactgttcgccaggtggcacaggagcagttctttttaatgtgc
accagatgttgcatgggacacaggcctctacttttcttcattactctgctcttcaccgtt
ttggggagcacagccagagagagagctaaacattcaggcgactactttactcttttaagg
caccttcttaattatgcctacaatagtaatattaacatacccaatgcagaagttcttctc
aataacgaaattgattggcttaagagaatcagggatgatgttaagagaacaggtgaaacg
ggtattgaagagacgatcttggaaggtcatcttggggtaacaaaagaattactggctttt
caaacccctgagaaaaagtatcatattggttgtgaaaaaggaggtgctaatctcattaaa
gaattaattgatgatttcatcttccctgcgtccaatgtttacctgcagtatatgagaaat
ggagaactgccagccgaacaggctattccagtctgtggttcaccagctaccattaatgcg
ggctttgagttacttgtagcattagctgttggctgtgtgaggaacctcaaacagatagta
gattctttgactgaaatgtactacattggcacagcaataactacttgtgaagcacttacc
gagtgggaatatctaccacctgttggaccccgcccaccaaaaggatttgtcgggctgaaa
aacgctggtgctacttgttacatgaactctgtgattcagcagctctacatgattccgtcc
attaggaatggtattcttgcaattgaaggcacaggtagtgatgtagacgatgatttgtct
ggggatgagaagcaggacaatgagagcaatgttgatcccagagatgatgtatttggatac
cctcaacaatttgaagacaaaccagcattaagtaaaacagaagacagaaaagagtacaat
attggtgttttgagacaccttcaggtcatctttggtcatttagctgcttctcgactacag
tactatgtgcccagaggattttggaaacagttcaggctttggggtgagcctgttaatctt
cgtgaacaacatgatgctttagaattttttaattcattggtggatagtttagatgaagct
ttgaaagccttaggacatccagctatgctaagtaaagtcttaggaggttcctttgcggat
cagaagatttgccaaggctgcccacatagatacgagtgtgaagaatcttttacgactttg
aatgtagacattagaaatcaccaaaatcttcttgattctttggaacaatatgtcaaagga
gatttattagaaggtgcaaatgcttatcattgtgaaaaatgcaataaaaaggttgatact
gtaaagcgcttgcttattaaaaaattgcctcctgttcttgctatccaactaaaacgattc
gactatgattgggaaagagaatgtgcaatcaagtttaatgattattttgaatttcctcgt
gagctggacatggaaccgtacacagttgcaggtgttgcaaagctggaaggagataatgta
aacccagagagtcagttgatacaacagaatgagcagtctgacagtgagacagcaggaagc
acgaaatacagacttgtcggggtgcttgtacacagcggtcaagcaagcggaggacattac
tattcttacatcattcaaaggaatggaggagatggtgagagaaaccgttggtacaaattt
gatgatggagatgtaactgaatgtaaaatggatgacgatgaagaaatgaaaaaccagtgt
ttcggtggagagtacatgggagaagtattcgatcacatgatgaagcgcatgtcatacagg
cgccagaaaaggtggtggaatgcttatatacttttttatgaacgattggacacaatagac
cagggtgatgaattgatacgatacatatcagagcttgctatcaccgcaagaccccatcag
attattatgccatcagccattgagagaagtgtacggaaacagaacgtgcaattcatgcat
aaccgaatgcaatacagtatggaatattttcagtttatgaaaaaactgcttacatgtaat
ggtgtttacttaaatcctcctccagggcaagatcacctgttgcctgaagcagaagaaatc
acaatgattagtattcagcttgccgctaggttcctctttaccacaggatttcacaccaag
aaaatagtccgtggctccgccagtgattggtatgatgcattatgtattctccttcgtcac
agcaagaatgtacgattttggtttgctcataatgtcctttttaatgtttcaaatcgcttc
tctgaataccttctggagtgccctagtgcagaagtgagaggtgcatttgcaaaactgata
gtttttattgcacatttttccttgcaagatgggccatgtccatcgccttttgcatctcca
ggaccttctagtcaggcttatgacaacttaagcctgagtgatcacttactaagagcagta
ttaaatctgctgagaagagaagtttcagagcatgggcgtcatttacagcagtatttcaac
ctgttcgtaatgtatgccaatttaggtgtggcagagaagacacagcttctgaaattgagt
gtacctgctacctttatgcttgtgtctttagacgaaggtccgggtcctccaatcaagtat
cagtatgctgaattaggcaaattatactcggtagtgtcacagctaatccgctgttgcaat
gtctcatcaagaatgcagtcttcaatcaatggtaaccctcctcttcccaatccttttggt
gatcctaatttatcacaacctataatgccaattcagcagaacgtggcagacattttattt
gtgaggacaagttatgtgaagaaaatcattgaggactgcagcaactcagaggaaaccgtc
aaattgcttcgtttttgctgctgggagaatcctcagttctcatctactgtcctcagtgaa
cttctctggcaggtggcatattcctacacttatgaactccggccctacttggatctgctt
ctgcagatcttgctgattgaggactcctggcagactcacagaattcacaacgcacttaaa
ggaatcccagatgaccgagatgggctgtttgacacaatccagcgctctaagaatcactat
caaaaaagagcataccagtgtataaaatgtatggtagcgctctttagcaattgtcctgtt
gcttaccagattctacagggaaatggagatcttaaaaggaagtggacctgggcagtggaa
tggcttggggatgaacttgaaagacgaccatacactggcaatcctcaatacacttacaac
aattggtctcctccagtgcaaagcaatgaaacatcaaatggttatttcttggagagatca
catagtgctaggatgacacttgcaaaagcttgtgaactctgtccagaggaggtaaaaaaa
gccaccagtgtgcagcagatagaaatggaagaaagcaaagaaccagatgaccaagatgcc
ccagatgagcatgagtcacctccacctgaagatgccccgttatacccccactcacctgga
tctcagtatcagcagaataaccatgtgcatggacagccgtatacaggcccagcagcacat
cacatgaacaaccctcagagaactggccagcgagcacaagaaaattacgaaggcagtgaa
gaagtgtccccgccccagacgaaggatcagtga

DBGET integrated database retrieval system