KEGG   Bos taurus (cow): 507571Help
Entry
507571            CDS       T01008                                 

Gene name
DYRK1B, DYRK1A
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1B (EC:2.7.12.1)
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     507571 (DYRK1B)
Protein kinases [BR:bta01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [Table]
   507571 (DYRK1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
18
AA seq 629 aa AA seqDB search
MAVPPGHGPFSGFPGPQEHTQVLPEVRLLPRRLPLAFRDATSAPLRKLSVDLIKTYKHIN
EVYYAKKKRRAQQAPPQDSSTKKEKKVLNHGYDDDNHDYIVRSGERWLERYEIDSLIGKG
SFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMNQHDTEMKYYIVHLKRHF
MFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDL
KPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLG
CILVEMHTGEPLFSGSNEVDQMNRIVEVLGIPPAPMLDQAPKARKYFERLPGGGWTLRRT
KELRKDYQGPGTRRLQEVLGVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARI
SPLGALQHGFFRRTADEATNTGPAGSSASTSPAPLDTCPSSSTASSISSSGGSSGSSSDN
RTYRYSNRYCGGPGPPITDCEMNSPQVPPSQPLRPWAGGDVPHKTHQAPASASSLPGAGA
QLPAQPRCLGRPPSPTSPPPPELMDVSLVGGPPDCSPPHPAPAPQHPAASALRTRMTGGR
PPLPPPDDPATLGPRLGLRGVPQSTAASS
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcccaccgggccatggtcccttctctggcttcccggggccccaggagcacacg
caggtgctgccggaagtacggctcctgccgcggaggctgcccctggccttccgagacgca
acctcggccccgctgcgtaagctctccgtggacctcatcaagacctacaagcacatcaat
gaggtgtactatgcgaagaagaagcggcgggcccagcaggcgccacctcaggactcgagc
accaagaaggagaaaaaggtcctgaaccacggttacgacgatgacaaccatgactacatc
gtgcgcagcggcgagcgctggctggagcgctatgagattgactcactcattggcaaaggc
tcctttggccaggtggtgaaggcctatgaccatcagacccaggagctggtggccattaag
atcatcaagaacaagaaagccttcctgaaccaggcccagattgagctgcggctgctggag
ctgatgaaccagcacgacacagagatgaagtactacatagtgcacctgaagcggcacttc
atgttccggaaccacctgtgcctggtgttcgagctgctctcctacaacctgtacgacctc
ttgcgcaacacgcacttccgcggcgtctcgctcaacctgacgcggaagctggcgcagcag
ctctgcacggcgctgctcttcctggccacgcccgagctcagcatcattcactgcgacctc
aagcccgagaacatcctgctctgcaaccccaagcgcagcgccatcaagatcgtggacttc
ggcagctcctgccagctcggccagcggatctaccagtacatccagagccgtttctaccgt
tcgcccgaggtgctcctgggcactccctacgacctggccattgacatgtggtcccttggc
tgcatcctggtggagatgcacactggagagcccctcttcagtggctccaatgaggtggac
cagatgaaccggatcgtggaggtgctgggcatcccaccagcccccatgctggaccaggcg
cccaaggctcgaaagtactttgagcggctgcctgggggcggctggaccctacgaaggaca
aaggaactcaggaaggattaccagggccccgggacacggcggctgcaggaggtgctgggc
gtgcagacgggcgggcccgggggccggcgggcgggggagccgggccacagccccgccgac
tacctccgcttccaggacctggtgctgcgcatgctggagtatgagcccgccgcccgcatc
agcccgctgggggcgctgcagcacggcttcttccgccgcacggctgatgaggccaccaac
acgggcccggcgggcagcagtgcctccacctcgcccgcacccctcgacacctgcccctcc
tccagcaccgccagctccatctccagctccggaggctccagtggctcctccagtgacaac
aggacctaccgctatagcaaccgatattgtgggggccctgggccccccatcactgactgt
gagatgaacagcccccaggtcccgccctcccagccgctgcgcccctgggccgggggggat
gtgccccacaagacacatcaggcccctgcctctgcctcatcactgccaggggctggagcc
cagttacccgcccaaccccgatgccttggtcgtcccccatcaccaacctcaccaccaccc
ccggagctgatggatgtgagcctggtgggcgggcccccagactgctccccacctcaccca
gcgcctgccccccagcacccagctgcctcagccctccggactcggatgacagggggtcgt
ccacccctcccaccccccgatgaccctgccaccctggggcctcgcttgggcctccgtggt
gtaccccagagcacggcagccagctcatga

DBGET integrated database retrieval system