KEGG   Bos taurus (cow): 507731Help
Entry
507731            CDS       T01008                                 

Gene name
CDC25C
Definition
cell division cycle 25 homolog C (S. pombe) (EC:3.1.3.48)
Orthology
K05867  
M-phase inducer phosphatase 3 [EC:3.1.3.48]
Organism
bta  Bos taurus (cow)
Pathway
Cell cycle
Oocyte meiosis
Progesterone-mediated oocyte maturation
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    507731 (CDC25C)
   04114 Oocyte meiosis
    507731 (CDC25C)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    507731 (CDC25C)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    507731 (CDC25C)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     507731 (CDC25C)
Protein phosphatases and associated proteins [BR:bta01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     507731 (CDC25C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
7
AA seq 477 aa AA seqDB search
MSAEFFSSKREEGSLASGPSFRSNQRKILNLLLERDASFSISSDLPTTPVEKKLFGDSAN
LSILSGGTPKRCLDLSNLSSGEMSATQLTASADLDETGHLESTGPEQVRLAGMNYRQHLI
KCSPAQLFCSTPNALEHGRRKKDAICGSSANKENDNGNLVENEMKHLGSPITTVSKLHKN
PELAEDQAEEISDELMEFSLEDQEKAKPPLNWSSLYRSSSLPDSLNSPSLKQVVKFKDST
IPDKLKKKYCSNQKELGKGLGLKKMVSLCDINMTQMLEEDSNQGPLIGDFSKVCALPTVS
GKHQDLKYVNPETVAALLSGEFQGLIEKFYIIDCRYPYEYLGGHIQGALNLHSQEELYNF
FLKKPIVPWDNQKRIVIVFHCEFSSERGPRMCRSLREEDRTLNQYPALYYPELYILKGGY
RDFFPEYMELCEPQSYCPMHHQDHKAELLRCRNQSKAWEGERQLQEQIALLVKDVSP
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcagaattcttctcatccaaaagagaggagggaagccttgcctcaggacctagt
tttaggtccaatcagaggaagatattaaacctgctccttgagagagatgcttccttttcc
atcagttcagatctccctacaactccagtggagaagaaactttttggtgactctgcaaac
ctaagcattttgtctggaggaaccccaaaacgttgccttgatctttcgaatcttagcagc
ggggagatgtctgccactcagcttactgcttctgcagaccttgatgaaactggtcatttg
gagtctacaggacctgagcaagtacggttagctggaatgaattaccgccaacatcttata
aaatgtagcccagcacagctgttttgtagcactccgaatgccttggagcatggccgcagg
aagaaagatgcaatatgtggctcatctgcaaataaggaaaatgacaatggaaacttggtg
gaaaatgaaatgaaacatctgggcagtcccattactacagtttcaaaattacataaaaat
ccagagctagcagaagatcaggcagaagagatatcagatgaattgatggagttttcactg
gaagatcaagaaaaggccaagccacctctgaactggagctccctgtatcgctcctcatca
ttgccagacagcttaaacagtccaagtttgaagcaggtggtaaaattcaaggacagcaca
ataccagataaactaaaaaagaagtattgttcaaaccaaaaagagctcggaaagggctta
ggtctaaagaaaatggtctccctctgtgacatcaatatgactcagatgctggaggaagat
tcaaaccaggggcctctgattggtgatttctccaaggtatgtgcactgccaaccgtgtca
gggaaacaccaagatctgaagtacgtcaacccagaaacagtggctgccttactatcaggg
gagttccagggtctgattgagaagttttatatcatcgattgccgctatccatatgagtac
ctgggaggacacattcagggagcattaaacttgcacagtcaagaagaactatataacttc
tttctgaagaaacccattgtcccttgggataaccagaaaagaatagtcatcgtgttccat
tgtgaattctcctctgagaggggtccccgaatgtgccgttctctgagagaagaggacagg
actctgaaccagtatcctgccctgtactacccagagctatacatcctcaaagggggctac
agagacttctttccagaatatatggagctgtgtgaaccacagagctactgcccgatgcat
caccaggaccataaggctgagctgctgaggtgtcgaaaccagagcaaagcatgggaagga
gagcggcagctgcaggaacagattgccttactggtgaaggatgtgagcccatga

DBGET integrated database retrieval system