KEGG   Bos taurus (cow): 507912Help
Entry
507912            CDS       T01008                                 

Gene name
RPA2
Definition
(RefSeq) replication protein A2
  KO
K10739  replication factor A2
Organism
bta  Bos taurus (cow)
Pathway
bta03030  DNA replication
bta03420  Nucleotide excision repair
bta03430  Mismatch repair
bta03440  Homologous recombination
bta03460  Fanconi anemia pathway
Module
bta_M00288  RPA complex
Brite
KEGG Orthology (KO) [BR:bta00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    507912 (RPA2)
   03420 Nucleotide excision repair
    507912 (RPA2)
   03430 Mismatch repair
    507912 (RPA2)
   03440 Homologous recombination
    507912 (RPA2)
   03460 Fanconi anemia pathway
    507912 (RPA2)
DNA replication proteins [BR:bta03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    507912 (RPA2)
DNA repair and recombination proteins [BR:bta03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     507912 (RPA2)
   MMR (mismatch exicision repair)
     507912 (RPA2)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     507912 (RPA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPA_C tRNA_anti-codon Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 507912
NCBI-ProteinID: NP_001039449
BGD-bta: BT27683
Ensembl: ENSBTAG00000006225
UniProt: Q2KI86
Position
2
AA seq 270 aa AA seqDB search
MWNSGFESYSTSSFGGAGGYTQSPGGFGSPTASQAEKKSRARAQHIVPCTISQLLSATLV
DEVFRIGNVEISQVTIVGIIRNAEKAATNIVYKIDDMTAAPMDVRQWVDTDDASSENTVV
PPETYVKVAGHLRSFQNKKSLVAFKIIPLEDMNEFTTHILEVVNAHMMLSKSNSQPSAGR
APISNPGMGEAGNFGGNNFIPANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLQHMSVA
SIKLAVDFLSNEGHIYSTVDDDHFKSTDAE
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtggaatagtggatttgaaagctatagcacctcctctttcgggggagccggcggctac
acacagtcccctgggggctttggatctccgacagcttcccaggccgaaaagaaatccaga
gctcgagctcagcacattgtaccctgtaccatatctcagctgctttcggctactctggtt
gatgaagtattcagaattggaaatgttgagatttcacaggtcactattgtggggattatc
agaaatgcagagaaggctgcaaccaacattgtttacaagatagatgacatgacagctgca
cccatggatgttcgccagtgggttgacacagatgatgccagcagtgaaaacactgtggtc
cctccagaaacatatgtgaaagtggctggtcatctgagatctttccagaacaagaaaagc
ctggtagcctttaagatcattcccctggaggatatgaatgagtttaccacacacattctg
gaagtagtcaatgcacacatgatgctgagcaagtcgaacagccagccttcagcagggaga
gcacctatcagcaatccaggaatgggtgaagctgggaacttcggtgggaataacttcata
ccagcaaatggcctcactgtggcccagaaccaggtgctgaatttgatcaaggcttgccca
agacctgaaggattgaactttcaggatctcaagaaccaactccaacacatgtccgtagcc
tcaatcaagctagctgtggattttctaagcaacgagggacacatctattccaccgtggat
gatgatcattttaaatccacagacgcagaataa

DBGET integrated database retrieval system