KEGG   Bos taurus (cow): 507988Help
Entry
507988            CDS       T01008                                 

Gene name
CYP3A4
Definition
cytochrome P450, subfamily IIIA, polypeptide 4
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
bta  Bos taurus (cow)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Bile secretion
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    507988 (CYP3A4)
   00591 Linoleic acid metabolism
    507988 (CYP3A4)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    507988 (CYP3A4)
 Organismal Systems
  Digestive system
   04976 Bile secretion
    507988 (CYP3A4)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    507988 (CYP3A4)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     507988 (CYP3A4)
Cytochrome P450 [BR:bta00199]
 Cytochrome P450, animal type
  CYP3 family
   507988 (CYP3A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
25
AA seq 503 aa AA seqDB search
MELILSFSTETWVLLATGLVLLYLYGTYSYGLFKKLGVPGPRPLPYFGNILSYRKGVCEF
NEECFKKYGKIWGIFEGKQPLLVITDPDMIKTVLVKECYSVFTNRRVFGPSGVMKNAISV
AEDEQWKRIRTLLSPTFTSGKLKEMFPIIGKYGDVLVRNLRKEAEKGTSVDIKDIFGAYS
MDVITSTSFGVNIDSLSNPQDPFVENVKKLLRFSILDPFLLAVVLFPFLVPILDVLNITI
FPKSVVNFFTKSVKRIKESRLKDNQKPRVDFLQLMINSQNSKETDNHKALSDQELIAQSI
IFIFAGYETTSSTLSFLLYILATHPDVQQKLQEEIDATFPNKAPPTYDVLAQMEYLDMVV
NETLRMFPIAIRLERLCKKDVEIHGVSIPKGTTVMVPISVLHKDPQLWPEPEEFRPERFS
KKNKDSINPYVYLPFGTGPRNCIGMRFAIMNMKLAIVRVLQNFSFKPCKETQIPLKISSQ
GVLRPEKPVVLKVVLRDGTISGA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggagctaatcctgagcttttccacggaaacctgggttctcctggctaccggtctggtg
ctcctctatctatatggaacatattcctatgggctttttaagaagttgggagttcctgga
ccaagacctctaccttattttggaaacattctgtcctaccgaaagggtgtatgtgagttt
aatgaagaatgttttaaaaagtatgggaaaatttgggggatttttgaaggtaaacaacct
ctgttggttatcacagatccagacatgatcaaaacagtactagtgaaagaatgttattct
gtcttcacaaaccggagggtttttggtccatcgggagttatgaaaaatgctatttctgtg
gctgaggatgaacaatggaagagaatacggacattgctgtctccaaccttcaccagtggg
aagctcaaggagatgttccctatcattgggaagtatggagatgtgttggtgaggaacctg
aggaaggaagcagagaaaggcacgtctgtcgacattaaagacatctttggagcctacagc
atggatgtgattactagcacatcatttggagtgaatattgattcgctcagcaacccacaa
gatccctttgtggagaatgtcaagaagctcttaagatttagtatcctcgatccctttctt
ctcgcagtagtactctttccattccttgtcccaatccttgatgtattaaatatcaccata
tttccaaaaagtgttgtgaatttttttacaaaatctgtaaaaaggataaaagaaagtcgc
ctcaaagataatcaaaagccacgtgtggactttcttcagctgatgattaactcccagaat
tccaaagaaacagacaatcataaagctctctctgaccaagaactcatagcccagagtatt
atctttatttttgctggctatgagaccactagcagtactctttccttccttctgtatatt
ttggccactcaccctgatgtccagcagaagctgcaggaggagattgatgcaactttcccc
aataaggcccctccgacctatgatgtcctggcacagatggagtaccttgacatggtggtg
aatgagactctcagaatgtttcctattgctattagacttgagaggctctgtaagaaggat
gtggaaatccatggggtgtccattcccaaagggacaacagtgatggtgccaatctccgtg
ctgcacaaagacccacagctctggccagagcctgaggagttccgtcctgaaaggttcagt
aagaagaacaaggacagcataaatccttacgtctacctgccttttggaactggaccccga
aattgcattggcatgaggtttgctatcatgaacatgaaacttgctatcgtcagagtcctg
cagaacttctccttcaaaccttgtaaagaaacacagatccccttgaaaataagcagtcaa
ggagttttaagaccggaaaaacctgttgtcctaaaggttgtgctcagagatggaaccata
agtggagcctga

DBGET integrated database retrieval system