KEGG   Bos taurus (cow): 508042Help
Entry
508042            CDS       T01008                                 

Gene name
USP4
Definition
ubiquitin specific peptidase 4 (proto-oncogene) (EC:3.4.19.12)
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
bta  Bos taurus (cow)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
22
AA seq 963 aa AA seqDB search
MAEGGGYRERPDAETQKSELGALMRTTLQRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVG
EHNLYPGPIDNSGLFSDPESQTLKEHLIDELDYVLVPAEAWNKLLNWYGCVEGQQPIVRK
VVEHGLFVKHCKVEVYLLELKLCENSDPTNVLSCHFSKADTIATIEKEMRKLFNIPAERE
TRLWNKYMSNTYEQLSKLDNTVQDAGLYQGQVLVIEPQNEDGTWPRQTQQSKSSTAPSRN
FTTSPKSSASPYSSVSASPIANGDSTNTSGMHSSGVSRGGSGFSASYNCQESPLTHVQPG
LCGLGNLGNTCFMNSALQCLSNTAPLTDYFLKDEYEAEINRDNPLGMKGEIAEAYAELIK
QMWSGRDAHVAPRMFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRVKKKPYLEL
KDANGRPDAVVAKEAWENHRLRNDSVIVDTFHGLFKSTLVCPECAKVSVTFDPFCYLTLP
LPLKKDRVMEIFLVPADPRCRPTQYRVVVPLMGAVSDLCEALSKLSGIAAENMVVTDVYN
HRFHKIFQMDEGLNHIMPRDDIFVYEVCSTSPDGSECVTLPVYFRERKSRPSSTSTGAVL
YGQPLLVSVPKHKLTLESLYQAVCERISRYIKQPLPDESGSSPLELGACNGSRSGCAGED
EEEMEHQEEGREQLSETEGSGDDEPGSDHGEATQKKNKGRPCPRRLFTFSLVNSYGTADI
NSLATDGKLLKLNSRSTLAIDWDSETRSCYYNEQESETYEKHVSMLQPQKKKKTAVALRD
CIELFTTMETLGEHDPWYCPNCKKHQQATKKFDLWSLPKILVVHLKRFSYNRYWRDKLDT
VVEFPVRGLNMSEFVCDPSARPYVYDLIAVSNHYGAMGVGHYTAYAKNKLNGKWYYFDDS
NVSLACEDQIVTKAAYVLFYQRRDDEFHKTPSLSFPGSSDGGARPSSSQQGTGDDETYSM
DTN
NT seq 2892 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaggcggagggtaccgtgagcgaccggatgcggagacccagaaatccgagctc
ggggccttgatgaggaccactctccagcgaggggcgcagtggtatcttattgacagccgg
tggttcaagcagtggaagaagtacgtgggcttcgacagctgggatatgtacaatgtgggt
gaacataatctgtatcctggcccgatagataactccggactcttttcagatcctgagagt
cagaccttaaaggaacatttaattgatgaattggactatgttttggtcccagcagaggcc
tggaataagttactaaactggtatggctgcgtagaaggccagcagcccattgtcagaaaa
gtggtagaacatggcctgtttgtcaagcactgcaaggtggaggtatatttgctggaactg
aagctttgtgagaacagtgaccccaccaacgtgctgagctgccatttcagcaaggcagac
accatcgcaaccatcgagaaggagatgaggaagctcttcaacatccctgcagagcgtgag
acacggctgtggaacaaatacatgagcaacacctacgagcagctgagcaagctggacaac
actgtgcaggatgccgggctgtaccagggtcaggtgctagtaattgagccccaaaatgaa
gatggcacatggccaaggcagacccagcaatcaaaatcaagcactgcgcctagcagaaat
tttactacctctccaaaatcatcagcaagtccctattcctcagtgtctgcctctcccatt
gcaaatggtgatagcactaacacctcggggatgcacagctccggtgtcagcaggggtgga
tctggcttctctgcttcgtataattgtcaggagtccccattgactcacgtccaacctggg
ctctgcggacttggaaacctggggaacacctgcttcatgaactccgctttgcagtgctta
agcaacacagcaccgttgactgactactttctcaaagatgaatacgaagccgaaatcaac
agggacaaccccctgggaatgaaaggggaaattgcagaggcctacgcagagctcattaag
cagatgtggtctggcagggatgctcacgtggcacctcgaatgttcaagactcaggtggga
cgttttgcccctcagttttctggctaccaacaacaagactctcaggagcttttagccttt
cttctagatggcttgcatgaagatctgaaccgtgtgaagaaaaaaccctacctagagctg
aaggatgccaatgggcggccagatgcggtggtggcaaaggaagcctgggagaatcatagg
ttgaggaatgattctgtgattgtggacacgttccatggcctcttcaaatctacattggtt
tgcccagaatgtgctaaggtttctgtgacctttgacccattttgctatctaactctccca
ttgcccttgaagaaagaccgagttatggagatcttcctagttcctgccgaccctcgctgc
aggcctacccagtaccgtgtggttgtgccactgatgggggccgtgtccgacctgtgtgag
gctctctccaagctgtctggcattgctgcagaaaacatggtggtcacagatgtgtataat
caccggttccacaagattttccaaatggatgaaggtttaaaccacatcatgcctcgggat
gacatttttgtgtacgaagtctgcagcacctccccggatggctctgagtgtgtcacgctt
cccgtgtacttcagggagaggaaatctaggccgtcgagcacttctaccggggcagtgctg
tacgggcagccactgctggtttctgtccccaagcacaagctcaccctcgagtctttgtac
caggcggtttgtgagcgcatcagccgatacataaaacagcctttgcctgatgagtcaggc
agctcgcccttggagctgggagcctgcaatggctccaggagcggctgtgcaggtgaagat
gaagaagaaatggagcatcaggaagaaggcagagagcagctctcagaaacggagggcagt
ggggacgatgagccgggaagtgaccacggtgaggccacccaaaagaagaacaaaggccgg
ccttgccccagaaggctttttaccttcagcctcgtgaactcctatggcacagctgacata
aattcccttgccactgatgggaaactactgaaactcaactctcggtccacgctagccatc
gactgggacagtgagacccggagctgttactacaacgaacaggaatctgagacgtacgag
aagcacgtcagcatgttgcaacctcagaagaaaaagaagacggcggtggccctgagggac
tgcatcgagctcttcactaccatggagacccttggggaacatgacccctggtactgtccc
aactgtaagaagcaccagcaggccacaaagaagtttgacctgtggtccttgccgaagatc
ctggtggtccacctcaaacgtttctcctacaatagatactggagggataagcttgataca
gtcgtggagttcccagtcagaggtctgaacatgtcggagtttgtctgtgacccgtcagcg
aggccatatgtgtacgatctcatcgccgtgtccaatcactatggagccatgggggttggc
cactacactgcgtacgcgaagaacaaactgaacgggaagtggtattactttgatgatagc
aatgtgtccctggcctgtgaggatcagatagtgacgaaagcagcttacgtgctgttctac
cagcgtcgagacgatgagtttcataagacgccgtcactcagttttcctggctcttctgat
ggaggtgcaagaccaagcagctcacagcagggcacgggggatgacgagacttacagcatg
gacaccaactga

DBGET integrated database retrieval system