KEGG   Bos taurus (cow): 508160Help
Entry
508160            CDS       T01008                                 

Gene name
PADI3
Definition
peptidyl arginine deiminase, type III
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     508160 (PADI3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 664 aa AA seqDB search
MSLQRIVRVSLEHPTSAVCVAGVETLVDIYGSVPEGTETFEVYGTPGVDIYICPNVERDR
ERADARRWHFDMGSQIIVVMNSPSNELNDSHVQISYHSSRDSSPLAYALLYLTCVDITLD
CDLNCEGRQDRDFVDKRQWVWGPSGHGAILLVNCDRDSMSSDDQDNCDHHVRCLQDLEDM
SVMILRTQGPNALFDDHKLVLHTSSADAERARVFHACGPGDSCEAYRHVLGQNKVSYEVH
RFHGDEERFFVEGLSFPDAGFSGLVAFHVTLLDDSNEDFSESPIFTDTVVFRVAPWIMTP
STQPPLEVYVCRVKNNTCFVHAVAELARRAGCKLTVCPQAENRNDRWIQDEMELGYIQAP
HKTFPVVFDSPRNGELQNFPYKRILGPDFGYVTREPQDNSVSGLDSFGNLEVSPPVVANG
KEYPLGRILFGGNLPGSRGRRVTQVVRDFLHAQRVQPPVELFVDWLAVGHVDEFLSFVPV
ADGKGFRMLLASPSACLKLFQEKQKWGHGGALLFQGVAGNQEVNTVSISQVLSNGNLISY
NKFVQSCIDWNREVLKRELGLAERDIVDIPQLFKMERRKAVAFFPDLVNMLVLGQHLGIP
KPFGPVINGRCCLEEKVRSLLEPLGLHCTFIDDFTPYHMLHGEVHCGTNVRRQPFSFKWW
HMEP
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgcagaggattgtgcgcgtatccctggaacaccccaccagtgccgtgtgtgtg
gctggagtcgagaccctggtggacatttatgggtcagttcccgagggcacagagacgttc
gaggtctacggaacccccggcgtggacatctacatctgccccaacgtggagagggaccgg
gagcgtgcggatgcccggcggtggcactttgacatgggctcccagatcatcgtggtcatg
aactctcccagcaacgagctcaacgacagtcacgttcagatttcctaccattccagccga
gactcctcgcccctggcctacgcgctgctctacctcacctgtgtggatatcaccctggac
tgtgacctgaactgtgaaggcaggcaggacagggactttgtggacaagcggcagtgggtc
tggggacccagtgggcacggagccatcctgctggtgaactgcgacagagacagtatgagc
tctgacgaccaggacaactgtgaccaccacgtgcgctgcctgcaagacctagaagacatg
tctgtgatgattctgcggacacaaggccccaatgccctgtttgacgaccacaaactcgtc
ctccacacttccagcgctgacgccgagcgggcgcgggtgttccacgcctgcggccccggg
gactcctgcgaggcgtaccggcacgtgctcggccagaacaaggtgtcctacgaggtgcac
cgcttccacggcgatgaggagcgcttcttcgtggagggcctgtccttccccgacgccggc
ttctcggggctcgtcgccttccacgtcaccctgctggacgactccaacgaggatttctcc
gagtcccccatcttcaccgacaccgtggtgttccgagtggccccctggatcatgacgccc
agcacccagccgcccctggaggtgtacgtgtgccgcgtgaagaacaacacgtgcttcgtg
catgcggtggcagagctggccagaagggccggctgcaagctgactgtctgcccgcaggct
gagaaccgcaatgaccgctggatccaggacgagatggagctgggctacatccaggcgccg
cacaaaaccttcccggtggtctttgactcccccaggaatggcgagctgcagaacttccct
tacaaaagaatcctgggtccagatttcggctatgtgacccgggaaccacaagacaactct
gtaagcggcctggactccttcgggaacctggaggtcagcccccctgtggtagccaacggg
aaggagtaccccctggggcggatcctcttcggaggcaacttgcctgggtcaaggggccgc
cgggtcactcaggtggtccgggacttcctgcacgcccagagggtgcagccgcctgtcgag
ctcttcgtggactggctggcggtcggccacgtggacgagtttctgagcttcgtccctgtc
gctgacgggaagggcttccggatgctcctggccagccccagcgcctgcctcaagctcttc
caggaaaagcagaagtggggccacgggggcgccctcctgttccaaggggttgccggcaac
caggaggtcaacaccgtctccatcagccaggtcctctccaacggaaacctcatcagctac
aataagtttgtgcagagctgcatcgactggaaccgggaggtgctgaagcgggagctgggc
ctggccgagcgggacatcgtggacatcccgcagctcttcaagatggagaggaggaaggcc
gtggccttcttcccggacttggtgaacatgctggtgctgggccagcacctgggcatcccc
aagcccttcgggcccgtcatcaacggccgctgctgcctggaggagaaggtgcggtccctg
ctggagccactgggtctccactgcaccttcatcgacgacttcaccccgtaccacatgctg
cacggcgaggtgcactgcggcaccaacgtgcgccggcagcccttctccttcaagtggtgg
cacatggagccctga

DBGET integrated database retrieval system