KEGG   Bos taurus (cow): 508233Help
Entry
508233            CDS       T01008                                 

Gene name
RELA
Definition
(RefSeq) RELA proto-oncogene, NF-kB subunit
  KO
K04735  transcription factor p65
Organism
bta  Bos taurus (cow)
Pathway
bta01523  Antifolate resistance
bta04010  MAPK signaling pathway
bta04014  Ras signaling pathway
bta04024  cAMP signaling pathway
bta04062  Chemokine signaling pathway
bta04064  NF-kappa B signaling pathway
bta04066  HIF-1 signaling pathway
bta04071  Sphingolipid signaling pathway
bta04137  Mitophagy - animal
bta04151  PI3K-Akt signaling pathway
bta04210  Apoptosis
bta04211  Longevity regulating pathway
bta04218  Cellular senescence
bta04380  Osteoclast differentiation
bta04620  Toll-like receptor signaling pathway
bta04621  NOD-like receptor signaling pathway
bta04622  RIG-I-like receptor signaling pathway
bta04623  Cytosolic DNA-sensing pathway
bta04625  C-type lectin receptor signaling pathway
bta04657  IL-17 signaling pathway
bta04658  Th1 and Th2 cell differentiation
bta04659  Th17 cell differentiation
bta04660  T cell receptor signaling pathway
bta04662  B cell receptor signaling pathway
bta04668  TNF signaling pathway
bta04722  Neurotrophin signaling pathway
bta04917  Prolactin signaling pathway
bta04920  Adipocytokine signaling pathway
bta04926  Relaxin signaling pathway
bta04931  Insulin resistance
bta04932  Non-alcoholic fatty liver disease (NAFLD)
bta04933  AGE-RAGE signaling pathway in diabetic complications
bta05030  Cocaine addiction
bta05132  Salmonella infection
bta05133  Pertussis
bta05134  Legionellosis
bta05140  Leishmaniasis
bta05142  Chagas disease (American trypanosomiasis)
bta05145  Toxoplasmosis
bta05146  Amoebiasis
bta05152  Tuberculosis
bta05160  Hepatitis C
bta05161  Hepatitis B
bta05162  Measles
bta05164  Influenza A
bta05165  Human papillomavirus infection
bta05166  HTLV-I infection
bta05167  Kaposi's sarcoma-associated herpesvirus infection
bta05168  Herpes simplex infection
bta05169  Epstein-Barr virus infection
bta05200  Pathways in cancer
bta05202  Transcriptional misregulation in cancer
bta05203  Viral carcinogenesis
bta05212  Pancreatic cancer
bta05215  Prostate cancer
bta05220  Chronic myeloid leukemia
bta05221  Acute myeloid leukemia
bta05222  Small cell lung cancer
bta05321  Inflammatory bowel disease (IBD)
bta05418  Fluid shear stress and atherosclerosis
Module
bta_M00686  Toll-like receptor signaling
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    508233 (RELA)
   04010 MAPK signaling pathway
    508233 (RELA)
   04064 NF-kappa B signaling pathway
    508233 (RELA)
   04668 TNF signaling pathway
    508233 (RELA)
   04066 HIF-1 signaling pathway
    508233 (RELA)
   04071 Sphingolipid signaling pathway
    508233 (RELA)
   04024 cAMP signaling pathway
    508233 (RELA)
   04151 PI3K-Akt signaling pathway
    508233 (RELA)
 Cellular Processes
  Transport and catabolism
   04137 Mitophagy - animal
    508233 (RELA)
  Cell growth and death
   04210 Apoptosis
    508233 (RELA)
   04218 Cellular senescence
    508233 (RELA)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    508233 (RELA)
   04621 NOD-like receptor signaling pathway
    508233 (RELA)
   04622 RIG-I-like receptor signaling pathway
    508233 (RELA)
   04623 Cytosolic DNA-sensing pathway
    508233 (RELA)
   04625 C-type lectin receptor signaling pathway
    508233 (RELA)
   04660 T cell receptor signaling pathway
    508233 (RELA)
   04658 Th1 and Th2 cell differentiation
    508233 (RELA)
   04659 Th17 cell differentiation
    508233 (RELA)
   04657 IL-17 signaling pathway
    508233 (RELA)
   04662 B cell receptor signaling pathway
    508233 (RELA)
   04062 Chemokine signaling pathway
    508233 (RELA)
  Endocrine system
   04920 Adipocytokine signaling pathway
    508233 (RELA)
   04917 Prolactin signaling pathway
    508233 (RELA)
   04926 Relaxin signaling pathway
    508233 (RELA)
  Nervous system
   04722 Neurotrophin signaling pathway
    508233 (RELA)
  Development
   04380 Osteoclast differentiation
    508233 (RELA)
  Aging
   04211 Longevity regulating pathway - mammal
    508233 (RELA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    508233 (RELA)
   05202 Transcriptional misregulation in cancers
    508233 (RELA)
   05203 Viral carcinogenesis
    508233 (RELA)
   05212 Pancreatic cancer
    508233 (RELA)
   05221 Acute myeloid leukemia
    508233 (RELA)
   05220 Chronic myeloid leukemia
    508233 (RELA)
   05215 Prostate cancer
    508233 (RELA)
   05222 Small cell lung cancer
    508233 (RELA)
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    508233 (RELA)
  Substance dependence
   05030 Cocaine addiction
    508233 (RELA)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    508233 (RELA)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    508233 (RELA)
   04931 Insulin resistance
    508233 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    508233 (RELA)
  Infectious diseases
   05132 Salmonella infection
    508233 (RELA)
   05133 Pertussis
    508233 (RELA)
   05134 Legionellosis
    508233 (RELA)
   05152 Tuberculosis
    508233 (RELA)
   05166 HTLV-I infection
    508233 (RELA)
   05162 Measles
    508233 (RELA)
   05164 Influenza A
    508233 (RELA)
   05161 Hepatitis B
    508233 (RELA)
   05160 Hepatitis C
    508233 (RELA)
   05168 Herpes simplex infection
    508233 (RELA)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    508233 (RELA)
   05169 Epstein-Barr virus infection
    508233 (RELA)
   05165 Human papillomavirus infection
    508233 (RELA)
   05146 Amoebiasis
    508233 (RELA)
   05145 Toxoplasmosis
    508233 (RELA)
   05140 Leishmaniasis
    508233 (RELA)
   05142 Chagas disease (American trypanosomiasis)
    508233 (RELA)
  Drug resistance
   01523 Antifolate resistance
    508233 (RELA)
Transcription factors [BR:bta03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    508233 (RELA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RHD_DNA_bind RHD_dimer
Motif
Other DBs
NCBI-GeneID: 508233
NCBI-ProteinID: NP_001073711
BGD-bta: BT21551
Ensembl: ENSBTAG00000013895
UniProt: A1XG22
Position
29
AA seq 551 aa AA seqDB search
MDDLFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLAPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPGLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFNGPTDPRPPTRRIAVPNRGSASIPKPAPQPYSFTPSLSTINF
EEFSPMVFPSGQIPSQTSALAPAPTPVLTQTQVLAPAPAPAPGMASTLAQALAPGLAQAV
TPPAPRTNQTGEGTLTEALLQLQFDTDEDLGALLGNNTDPAVFTDLASVDNSEFQQLLNQ
GVPMGPHTAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGPPGLTNGLLSGDEDFSSIADV
DFSALLSQISS
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggacgacctcttccccctcatcttccctgcagagccggcgcaggcctctggcccctat
gtggagatcatcgagcagcccaagcagcggggcatgcgcttccgctacaagtgtgagggc
cgctcagctggcagcatccctggagagaggagcacggacaccaccaagacccaccccact
atcaagatcaatggctacaccgggccagggacagtccgcatctccctggtcaccaaggac
ccccctcaccggcctcaccctcacgagctagtggggaaagactgccgggatggcttctat
gaggctgagctctgcccggaccgctgcatccacagctttcagaacctggggatccagtgt
gtaaagaagcgggacctggagcaggccatcagccagcgcatccagaccaacaacaacccc
ttccaagttcccatagaagagcagcgcggggactacgacctgaatgccgtccggctctgc
ttccaggtgacagtgcgggacccggcaggcaggcccctccgcctggcgcctgtcctctct
caccccatctttgacaaccgcgcccccaacaccgccgagctcaagatctgccgggtgaat
cggaactctgggagctgcctcggcggggatgagatcttcctgctgtgtgacaaggtgcag
aaagaggacatcgaggtgtatttcacgggaccaggctgggaggcccgaggctctttttca
caagctgacgtgcaccggcaagtggccatcgtgttccggacgccgccctacgcggacccc
ggcctgcaggcccctgtgcgcgtctccatgcagctgcggcggccttccgatcgggagctc
agtgagcccatggaattccagtacttgccagacacagacgatcgtcaccggattgaggag
aagcgcaaaaggacgtacgagaccttcaagagcatcatgaaaaagagccctttcaatgga
cccaccgacccccggcctccaacccggcgcatcgctgtgcctaaccgcggctcagcctcc
atccccaagccagctccccagccctattcctttacgccatctctcagcaccatcaacttt
gaggagttttcccccatggtctttccttctgggcagatcccaagccagacctcggccttg
gcaccagcccccaccccggtcctgacccagacccaagtcctggccccagccccggcccca
gccccaggcatggcatcaaccctggcccaggccctagccccaggcctggctcaggctgtg
accccgcctgcccccaggaccaaccagaccggggaagggacactgacagaggccctgctg
cagctgcagtttgataccgatgaagacctgggggctctgcttggcaacaacactgaccct
gccgtgttcacagacctggcatctgtcgacaactctgagtttcagcagttgctgaaccag
ggtgtacccatgggcccccacacagctgagcccatgctgatggagtaccctgaggctata
actcgcctggtgacagggtcccaaaggccccctgacccagctcccactcccctggggccc
cctgggctcaccaatggcctcctctcgggggatgaagacttctcctccatcgcggatgtg
gacttctcagcccttctgagtcagatcagctcctaa

DBGET integrated database retrieval system