KEGG   Bos taurus (cow): 508233Help
Entry
508233            CDS       T01008                                 

Gene name
RELA
Definition
v-rel reticuloendotheliosis viral oncogene homolog A (avian)
Orthology
K04735  
transcription factor p65
Organism
bta  Bos taurus (cow)
Pathway
MAPK signaling pathway
Ras signaling pathway
Chemokine signaling pathway
NF-kappa B signaling pathway
HIF-1 signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Osteoclast differentiation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
T cell receptor signaling pathway
B cell receptor signaling pathway
TNF signaling pathway
Neurotrophin signaling pathway
Prolactin signaling pathway
Adipocytokine signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Cocaine addiction
Salmonella infection
Pertussis
Legionellosis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Amoebiasis
Tuberculosis
Hepatitis C
Hepatitis B
Measles
Influenza A
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
Pancreatic cancer
Prostate cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Small cell lung cancer
Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    508233 (RELA)
   04010 MAPK signaling pathway
    508233 (RELA)
   04064 NF-kappa B signaling pathway
    508233 (RELA)
   04668 TNF signaling pathway
    508233 (RELA)
   04066 HIF-1 signaling pathway
    508233 (RELA)
   04151 PI3K-Akt signaling pathway
    508233 (RELA)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    508233 (RELA)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    508233 (RELA)
   04621 NOD-like receptor signaling pathway
    508233 (RELA)
   04622 RIG-I-like receptor signaling pathway
    508233 (RELA)
   04623 Cytosolic DNA-sensing pathway
    508233 (RELA)
   04660 T cell receptor signaling pathway
    508233 (RELA)
   04662 B cell receptor signaling pathway
    508233 (RELA)
   04062 Chemokine signaling pathway
    508233 (RELA)
  Endocrine system
   04920 Adipocytokine signaling pathway
    508233 (RELA)
   04917 Prolactin signaling pathway
    508233 (RELA)
  Nervous system
   04722 Neurotrophin signaling pathway
    508233 (RELA)
  Development
   04380 Osteoclast differentiation
    508233 (RELA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    508233 (RELA)
   05202 Transcriptional misregulation in cancers
    508233 (RELA)
   05203 Viral carcinogenesis
    508233 (RELA)
   05212 Pancreatic cancer
    508233 (RELA)
   05221 Acute myeloid leukemia
    508233 (RELA)
   05220 Chronic myeloid leukemia
    508233 (RELA)
   05215 Prostate cancer
    508233 (RELA)
   05222 Small cell lung cancer
    508233 (RELA)
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    508233 (RELA)
  Substance dependence
   05030 Cocaine addiction
    508233 (RELA)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    508233 (RELA)
  Infectious diseases
   05132 Salmonella infection
    508233 (RELA)
   05133 Pertussis
    508233 (RELA)
   05134 Legionellosis
    508233 (RELA)
   05152 Tuberculosis
    508233 (RELA)
   05166 HTLV-I infection
    508233 (RELA)
   05162 Measles
    508233 (RELA)
   05164 Influenza A
    508233 (RELA)
   05161 Hepatitis B
    508233 (RELA)
   05160 Hepatitis C
    508233 (RELA)
   05168 Herpes simplex infection
    508233 (RELA)
   05169 Epstein-Barr virus infection
    508233 (RELA)
   05146 Amoebiasis
    508233 (RELA)
   05145 Toxoplasmosis
    508233 (RELA)
   05140 Leishmaniasis
    508233 (RELA)
   05142 Chagas disease (American trypanosomiasis)
    508233 (RELA)
Transcription factors [BR:bta03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    508233 (RELA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
29
AA seq 551 aa AA seqDB search
MDDLFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLAPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPGLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFNGPTDPRPPTRRIAVPNRGSASIPKPAPQPYSFTPSLSTINF
EEFSPMVFPSGQIPSQTSALAPAPTPVLTQTQVLAPAPAPAPGMASTLAQALAPGLAQAV
TPPAPRTNQTGEGTLTEALLQLQFDTDEDLGALLGNNTDPAVFTDLASVDNSEFQQLLNQ
GVPMGPHTAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGPPGLTNGLLSGDEDFSSIADV
DFSALLSQISS
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggacgacctcttccccctcatcttccctgcagagccggcgcaggcctctggcccctat
gtggagatcatcgagcagcccaagcagcggggcatgcgcttccgctacaagtgtgagggc
cgctcagctggcagcatccctggagagaggagcacggacaccaccaagacccaccccact
atcaagatcaatggctacaccgggccagggacagtccgcatctccctggtcaccaaggac
ccccctcaccggcctcaccctcacgagctagtggggaaagactgccgggatggcttctat
gaggctgagctctgcccggaccgctgcatccacagctttcagaacctggggatccagtgt
gtaaagaagcgggacctggagcaggccatcagccagcgcatccagaccaacaacaacccc
ttccaagttcccatagaagagcagcgcggggactacgacctgaatgccgtccggctctgc
ttccaggtgacagtgcgggacccggcaggcaggcccctccgcctggcgcctgtcctctct
caccccatctttgacaaccgcgcccccaacaccgccgagctcaagatctgccgggtgaat
cggaactctgggagctgcctcggcggggatgagatcttcctgctgtgtgacaaggtgcag
aaagaggacatcgaggtgtatttcacgggaccaggctgggaggcccgaggctctttttca
caagctgacgtgcaccggcaagtggccatcgtgttccggacgccgccctacgcggacccc
ggcctgcaggcccctgtgcgcgtctccatgcagctgcggcggccttccgatcgggagctc
agtgagcccatggaattccagtacttgccagacacagacgatcgtcaccggattgaggag
aagcgcaaaaggacgtacgagaccttcaagagcatcatgaaaaagagccctttcaatgga
cccaccgacccccggcctccaacccggcgcatcgctgtgcctaaccgcggctcagcctcc
atccccaagccagctccccagccctattcctttacgccatctctcagcaccatcaacttt
gaggagttttcccccatggtctttccttctgggcagatcccaagccagacctcggccttg
gcaccagcccccaccccggtcctgacccagacccaagtcctggccccagccccggcccca
gccccaggcatggcatcaaccctggcccaggccctagccccaggcctggctcaggctgtg
accccgcctgcccccaggaccaaccagaccggggaagggacactgacagaggccctgctg
cagctgcagtttgataccgatgaagacctgggggctctgcttggcaacaacactgaccct
gccgtgttcacagacctggcatctgtcgacaactctgagtttcagcagttgctgaaccag
ggtgtacccatgggcccccacacagctgagcccatgctgatggagtaccctgaggctata
actcgcctggtgacagggtcccaaaggccccctgacccagctcccactcccctggggccc
cctgggctcaccaatggcctcctctcgggggatgaagacttctcctccatcgcggatgtg
gacttctcagcccttctgagtcagatcagctcctaa

DBGET integrated database retrieval system