KEGG   Bos taurus (cow): 508257Help
Entry
508257            CDS       T01008                                 

Gene name
MYL7
Definition
(RefSeq) myosin light chain 7
  KO
K12754  myosin regulatory light chain 7
Organism
bta  Bos taurus (cow)
Pathway
bta04510  Focal adhesion
bta04670  Leukocyte transendothelial migration
bta04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:bta00001]
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    508257 (MYL7)
  Cell motility
   04810 Regulation of actin cytoskeleton
    508257 (MYL7)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    508257 (MYL7)
Cytoskeleton proteins [BR:bta04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     508257 (MYL7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 CHCH EF-hand_9
Motif
Other DBs
NCBI-GeneID: 508257
NCBI-ProteinID: XP_002686938
Ensembl: ENSBTAG00000002066
Position
4
AA seq 175 aa AA seqDB search
MASRKAGTRGKAAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKSDLRET
YSQLGKVNVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRLFDPSGKG
VVNKDEFRQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaggaaggcagggacccggggcaaggctgcggccaccaagcaggcccagcga
ggctcttccaacgtcttttccatgttcgagcaagcccagatccaggagttcaaggaagcc
ttcagctgcatcgaccagaaccgtgacggcatcatctgcaagtcggaccttagagagacc
tactcccagctcgggaaggtgaatgttccagaagaggagctggatgccatgctgcaggaa
gggaaggggcccatcaacttcactgtcttcctcacactgtttggggagaagctcaatggg
acagaccctgaagaggccatcctgagcgccttccgcctctttgaccccagtggtaaaggc
gtggtgaacaaggatgagttcaggcagcttctcctgacccaggcagacaagttctctcca
gctgaggtggagcaaatgttcgccctgacacccatggacctggcagggaacatcgactat
aagtccctgtgctacatcatcacccatggggacgagaaggaggagtga

DBGET integrated database retrieval system