KEGG   Bos taurus (cow): 508330Help
Entry
508330            CDS       T01008                                 

Gene name
KMT2A, MLL
Definition
lysine (K)-specific methyltransferase 2A
Orthology
K09186  
histone-lysine N-methyltransferase MLL1 [EC:2.1.1.43]
Organism
bta  Bos taurus (cow)
Pathway
Lysine degradation
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    508330 (KMT2A)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    508330 (KMT2A)
Enzymes [BR:bta01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     508330 (KMT2A)
Transcription factors [BR:bta03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    508330 (KMT2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
Position
15
AA seq 3713 aa AA seqDB search
MKRTPSATFQQATKIKKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTP
SGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRIIPSSKRTDATIAKQL
LQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYD
PPIKIARLESTPNSRFSATSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEE
IQVLPEERSDTPEVHTPLPISQSPEDDSSDRRSRRYSVSERSFGSRTTKKLSTLQSAPQQ
QTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPTSAAPMQGKRKSILREP
TFRWTSLKHSRSEPQYFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSTSGPAAS
ARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSNRTSAGTSSSGVSNRK
RKRKVFSPIRSEPRSPSHSMRTRSGRLSTSELSPLTPPSSVSSSLSISVGPLATSALNPT
FTFPSHSLTQSGESAEKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAP
EELSKERDADKSVEKDKSRERDREREKENKRESKKEKRKKGSEIQSSSALYPMGRVSKEK
AVGEDVATSSSAKKATGRKKSSSLDSGTDIASVTLGDTTAVKTKILIKKGRGNLEKSNLD
LGPTTPSLEKEKTLCLSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLC
KIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALGRKRAVFPDDMPTLSA
LPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRC
GQCPGCQVPEDCGVCTNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKK
KEKKSKTSEKKESKESSTVKNSVDSSQKSTPSAREDPAPKKSNSDPPPRKSVEDKSEEGN
TATPGPEAKHVATPASRKSSKQVSQPAPAIPPQPPSTAPPRKEVPKTTPSEPKKKPPPPP
ESGPEQSKQKKVAPRPSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKVPA
DGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASSGHVEFVYCQVCCEPF
HKFCLEENERPLEDQLENWCCRRCKFCHVCGRQHQAAKQLLECNKCRNSYHPECLGPNYP
TKPTKKKKVWICTKCVRCKSCGSTTPGKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKC
YDDDDYESKMMQCGKCDRWVHSKCENLSGTEDEMYEILSNLPESVAYTCVNCTERHPAEW
RLALEKELQISLKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESIPSRSSPEGPDPP
VLTEVSKQEDQQPLDLEGVKRKMDQGNYTSVLEFSDDIVKIIQAAINSDGGQPEIKKANS
MVKSFFIRQMERVFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDHNYAQWQEREENS
HTEQPPLMKKIIPAPKPKGPGEPDSPTPLHPPTPPILSTDRSREDSPELNPPPGIEDNRQ
CALCLTYGDDSANDAGRLLYIGQNEWTHVNCALWSAEVFEDDDGSLKNVHMAVIRGKQLR
CEFCQKPGATVGCCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDLIKGEVVPENGFE
VFRRVFVDFEGISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSDCEDKLFPIGYQCS
RVYWSTTDARKRCVYTCKIVECRPPVVEPDINSTVEHDENRTIAHSPPSFAEISPKESQN
TAEIVSPPSPDRPPHSQTSGSCFYHVISKVPRIRTPSYSPTQRSPGCRPLPSAGSPTPTT
HEIVTVGDPLLSSGLRSIGSRRHSTSSLSPQRSKLRIMSPMRTGSTYSRNSVSSVSTTGA
TADLESSAKAVDHVLGPLNSNANLGQNTPTSSNLQRTAVTVGTKTSHLDGSSSLETKHSS
ASDLTSKSSSLKGEKTKMPSSKNSEGSAHNVGYPGIPKLAPQVHNATAGELNVNKMGTFA
DLSSVPFSSKEGLPFPPLHLRGQRNERDQQTNGNQSANPNPDEDAEVKTLKLSGVSSRSS
IINEHVGASSRDRRQKGKKSCKETFKEKHSSKPFLEPGQVATGEEGNLKPEFVDEMLTPD
FMGQRSCNNVSSEKTGDKVHPIPGVPKAPSMQVEGSAKELQTPRKRTVKVTLTPLKMESE
GQSKNTLKESSPVSPLQIESVSPTEPVSASESPGDGPVAQPSPNNTSSQDSQSNNYQNLP
VQDRNLMLPDGPKPQEDGSFKRRYPRRSARARSNMFFGLTPLYGVRSYGEEDIPFYSSST
GKKRGKRSAEGQVDGADDLSTSDEDDLYYYNFSRTVISSGGEERLTPHNLFREEEQCDLP
KISQLDGIDDGTESDTSVTATTRKSSQIPKRNSKENGTENLKMDRPEDTGEKEHVIKSSV
GHKNEPKVDNCHAVSRVKAPGQDSLEAQLSSLESSRRVHTSTPSDKNLLDTYNTELLKSD
SDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLNLGEGLGLDSNREKDMG
LFEVFSQQLPTTEPVDSSVSSSISAEEQFELPLELPSDLSVLTTRSPTVPSQNSSRLAVI
SDSGEKRVTITEKASSEGDSSLLSPGVDPSPEGHMTPDHFIQGHMDADHISSPPCGSVEQ
GHGNNQDLTRNSNTPGLQVPVSPTVPIQNQKYAPNSTDSPGPSQISNAAVQTTPPHLKPA
TEKLIVVNQNMQPLYVLQTLPNGVTQKIQLTSSVSSAPSVMETNTSVLGPMGSGLTLTTG
LNPNLPASQSLFPPATKGLLPMSHHQHLHSFPAATQSSFPPNISSPSGLLIGVQPSPDPQ
LLVSEASQRTDLSTTVATPSSGLKKRPISRLQTRKNKKLAPSSTPSNIAPSDVVSNMTLI
NFTPSQLPNHPNLLDLGSLNTSSHRTVPNIIKRSKSGIMYFEQAPLLPQSVGGTTAPAAG
TATISQDTSHLTTGPVSGLASSSSVLNVVSMQTTTAPTSSASVPGHVALTNPRLLGTPDI
GSISNLLIKASQQSLGIQDQPVALPPSSGMFPPLGTSQTPSTGAMTAAPSICVLPSTQTA
GVTAASPSGEAEEHYQLHHVNQLLASKTGVLSSQRDLDSAPGSQGSSFTQTVDAPNPMGL
EQNKALPSAMQASSASPGGSPSSGQRSASPSVPGPTKPKPKIKRIQLPLDKGSGKKHKVS
HLRTSSSEAHIPDQEANTTPQTSVTGTPGAEAEPQDTASVEQSPQKECGQPAAQVAALPE
IQTTQNPAHEPENSEPKTAEEEESNFSSPLMLWLQQEQKRKESIAEKKPKKGLVFEISSD
DGFQICAESIEDAWKSLTDKVQEARSNARLKQLSFAGVNGLRMLGILHDAVVFLIEQLSG
AKHCRNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAFDMFNFLASKHRQPPEYNPNDE
EEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVI
EYAGNVIRSIQTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSR
VINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDASNKLPCNCGAKKCRKFLN
NT seq 11142 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcacgccttccgctacatttcagcaagccacaaagattaaaaaattaagagca
ggtaaactctctcctctcaagtccaagtttaagacagggaagcttcaaataggaaggaag
ggggtacagattgtacgccggcgaggacggcctccatcaacagaaaggataaagacccct
tcaggtctcctcattaactctgaactggaaaagccccagaaggtccggaaagacaaggaa
ggaacacctccactcacaaaagaagataagacagtagtcagacaaagccctcgaaggatt
aagccggttaggattattccttcttctaaaaggacagatgcaacaattgctaagcagctc
ttgcagagggcgaaaaagggggctcaaaagaagatcgagaaagaagcagctcagctgcaa
ggaagaaaggtgaagacacaggtcaaaaacatccgacagttcattatgcctgttgtcagt
gccatctcctcgcggatcatcaaaacccctcggcggttcatagaggatgaagattatgac
cctccaattaaaattgcccgactggagtctacaccgaacagtagattcagtgccacatcc
tgtggatcttctgaaaaatcaagtgcagcatctcagcactcctctcaaatgtcttcagac
tcctcccgatccagtagccccagtgtcgatacctccacggattctcaggcctctgaggag
attcaggtccttcctgaagagcggagcgatacccccgaagtccatacgccactgcctatt
tcccagtccccagaagatgacagcagtgaccggagaagcagaaggtattcggtgtcggag
agaagtttcggatccagaaccacgaaaaaattatccactctgcaaagtgccccccagcag
cagacctcttcctcgccccctccacccctgctgacaccaccgcccccactgcagccagcc
tccagtatctctgaccacacaccttggctcatgcctccaaccatccccttagcatcacca
tttttgcctacttccgccgctcccatgcaagggaagcgaaaatctattttgcgggaaccg
acgtttaggtggacttctctaaagcactctaggtcagagccacagtacttttcctcagca
aagtatgccaaagaaggtcttattcgcaaaccaatctttgataatttccgcccccctcca
ctcactcctgaggatgtcggcttcgcgtccgggttttctacgtctggtcctgctgcttca
gcccgattgttttcacctctccattctggaacaaggttcgatatgcacaaaaggagcccg
cttctgagagcgccgaggtttactccgagtgaggctcactctaggatatttgagtctgta
accttgcctagtaatcgaacttctgctggcacatcttcttcaggagtatctaacaggaaa
aggaaaagaaaggtgtttagccctattcgatccgaaccaagatctccttctcactctatg
aggacaagaagtggaaggcttagcacttctgagctgtcacctctcaccccaccgtcttct
gtctcctcctcattaagcatttctgttggtcctcttgccactagtgccttaaacccaact
tttacttttccttctcattccctgactcagtctggggaatctgcagagaaaaaccagaga
ccaaggaagcagaccagtgctccagcagagccattttcatccagtagtcccactcctctc
ttcccttggttcaccccaggctcccagactgaacgagggagaaataaagacaaggccccc
gaggagctgtccaaagagcgagatgctgacaagagtgtggagaaggacaagagtagagag
agagaccgggagagagaaaaggagaataagcgggagtccaagaaagagaaaaggaaaaag
ggatcagaaattcagagtagctcggctttgtatcctatgggtagagtttccaaagagaag
gctgttggtgaagatgtggccacttcatcttctgccaaaaaagcaaccgggcggaagaag
tcttcatcactcgattctgggactgatattgcttctgtgactcttggggatacgacagct
gtcaaaaccaaaatacttataaagaaagggagaggaaatctggaaaaaagcaacttggac
ctcggcccaactaccccatccctggagaaggagaaaaccctctgcctttccactccttca
tctagcactgttaaacattccacttcctccataggctccatgttggctcaggcagacaag
cttccaatgactgacaagagggttgccagcctcctaaaaaaggccaaagcccagctctgc
aagattgagaagagtaagagtcttaaacaaactgaccagcccaaagcacagggtcaagaa
agtgactcctcggagacctctgtgcgaggaccccggattaaacatgtctgcagaagagct
gctgttgcccttggccgaaaacgagctgtgtttcctgatgacatgcccaccctgagtgcc
ttaccatgggaagaacgagaaaagattttgtcttccatgggaaatgatgacaagtcatcg
atcgctggctcagaagatgctgaacctcttgctccacccatcaaaccaattaagcctgtc
accagaaacaaggcgcctcaggaacctccggtgaagaagggacggcgatccaggcggtgc
gggcagtgtcccggctgccaggtgcctgaggactgtggtgtttgcactaactgcttggat
aagcccaaatttggtggccgcaacataaagaagcagtgctgcaagatgcgaaaatgtcag
aatctacaatggatgccttccaaagcctaccttcagaagcaagcaaaagctgtgaaaaag
aaagagaagaaatctaagaccagtgaaaagaaggagagcaaagagagcagcactgtgaag
aactcggtggactccagtcagaaatctaccccatcggcaagagaggatcctgcccctaag
aaaagcaacagtgaccctcctccccgcaaatccgtggaggacaagagtgaggaagggaac
accgccaccccaggacctgaggccaagcacgtggccacgcccgcttccaggaagtccagc
aagcaggtctcccagccggcaccagccatccccccacaaccccccagcacagcaccaccg
agaaaagaagttcccaagaccactcccagtgagcccaagaaaaagccacctccacctcca
gagtcaggtccagagcaaagcaagcagaaaaaagtggctcctcgcccaagtattcctgta
aaacaaaagccaaaagaaaaggagaaaccacctccggtcaataagcaggaaaatgcaggc
actttgaacatcctcagcactctctccaatggcaatagctccaagcagaaagttccagca
gatggagtccacaggatcagagtggactttaaggaggattgtgaagcagaaaatgtgtgg
gagatgggaggcttaggaatcttgacctctgtccctataacacccagggtagtttgcttt
ctctgtgccagtagtggccacgtagagtttgtgtattgccaagtctgttgtgagcccttc
cacaagttttgtctggaggagaacgagcgccctctggaggaccagctggaaaactggtgt
tgtcgccgctgcaagttctgtcatgtctgtgggaggcagcatcaggctgcaaagcagctg
ctggagtgtaacaagtgccgaaacagctatcaccctgagtgcctgggaccaaattacccc
accaaacccacaaagaaaaagaaggtttggatctgtacgaagtgtgttcgctgcaagagc
tgtggatctacgactcccggcaaagggtgggatgcacagtggtctcacgatttctcactg
tgccatgattgtgccaaactctttgctaaaggaaacttctgccctctctgtgataagtgt
tatgatgatgatgactatgagagtaagatgatgcagtgtgggaaatgtgatcgatgggtc
cattccaaatgtgagaatctttcaggtacagaagatgagatgtatgagattctgtctaat
ctgccagagagtgtggcctacacgtgtgtgaactgcacagagcggcaccctgcggagtgg
cgactggcccttgagaaagagctccagatctcgctgaagcaagtactgacagccttgttg
aactctcggaccaccagccacctgctgcgctaccgacaggctgccaaacctccggactta
aatcctgagacagaggagagtataccttctcgtagctccccagaaggacctgatccacca
gtgctcactgaggtcagcaaacaggaagatcaacagcctttagatctggaaggagtcaag
aggaaaatggaccaagggaactacacatctgtgttggagttcagcgacgatatcgtgaag
atcattcaagcagccattaattcagatggagggcagccagagattaaaaaagccaacagc
atggtcaagtccttctttattcggcaaatggaacgtgtttttccatggttcagtgtcaaa
aagtccaggttttgggagccaaataaagtatcaagcaacagtgggatgttaccaaacgca
gtgcttccaccttcacttgaccataattatgctcagtggcaggagcgagaggaaaacagc
cacactgagcagcctcctttaatgaagaaaatcattccagctcccaaacctaaagggcct
ggagaaccagactcaccaactcctctgcatcctcctacaccaccaattttgagtactgat
aggagtcgagaagatagtccggaactgaacccacccccaggcatagaagataacagacag
tgtgcattgtgtttgacgtatggtgacgacagtgctaatgatgctggccgtttgctttac
attggccagaatgaatggacacatgtaaattgcgctctgtggtcagcagaagtgtttgaa
gacgatgatggatcactaaagaatgtgcatatggctgtgatcaggggcaagcagctgaga
tgtgaattctgccaaaagccaggagccactgtgggttgctgccttacatcctgcaccagc
aactatcacttcatgtgttcccgagccaagaactgtgtgtttctggatgataaaaaagtg
tattgccaacgacatcgggatttgatcaaaggcgaggtggttcctgagaatggatttgaa
gtttttagaagagtgtttgtggactttgaaggaatcagcttgagaaggaagtttctcaat
ggattagaaccagaaaatatccacatgatgattggctccatgacaattgactgcttaggg
attctgaatgatctctctgactgtgaggataagctctttcctattggatatcagtgttct
cgggtgtactggagcaccacggacgcccgcaagcgctgcgtgtacacgtgcaagatcgtc
gagtgccgtcccccggtggtggagccagatatcaacagcactgttgaacatgatgaaaac
aggaccatcgctcacagtccaccgtcttttgcagaaatttcacccaaggaaagtcaaaac
acagcagaaattgtaagtcctccatcaccagatcgacctcctcattcccaaacctctggt
tcctgtttctatcacgtcatctcaaaggtccctaggattcgaacacccagctattctcca
acacagagatctcctggctgtagaccactgccttctgcaggaagccctaccccaaccact
catgaaatagtcacagtgggtgaccctttactctcctctggacttcgaagcattggctcc
aggcgtcacagtacttcttccttgtcaccccagcggtctaagctccggataatgtctccg
atgagaactgggagcacttactccaggaacagtgtctcctctgtctccaccacaggggcc
actgcggatctggagtcaagtgccaaagcggtcgatcatgtcttagggccactgaattct
aatgctaatttagggcagaacactcccacctcttcaaatttgcaaaggacagcggttact
gtgggcactaaaaccagtcacttggatggctcttcatctttagaaacgaagcattccagt
gcttcagacttgacatccaagagctcctctttgaagggagagaagaccaaaatgccgagt
tccaagaactcagagggatcggcccataatgttggttaccctggcattccgaaactggct
ccgcaggttcataatgcaacagctggagaattaaatgttaataaaatgggcacttttgct
gacctttcttcagtgccattttcttctaaagagggcctccccttcccaccactccatttg
agagggcagagaaacgagcgagaccaacagacaaatggcaaccagtcagcaaaccccaat
cccgatgaagatgctgaagtcaaaaccttgaagctgtctggagtgagcagcagatcatcc
attatcaatgaacacgtgggagccagctccagagataggagacagaaagggaaaaaatct
tgtaaagaaactttcaaagaaaagcattccagtaaacctttcttggaacctggtcaggtg
gcaactggtgaggaaggaaacctaaagccagagtttgttgatgaaatgttgactcctgat
ttcatggggcaacgatcatgtaataatgtttcttctgagaagactggggacaaagtccat
cctattccaggagtccccaaagctccatccatgcaagtggaaggatctgcaaaggaatta
cagacaccccggaaacgcacagttaaagtaacactgacacctctaaaaatggagagtgag
ggtcagtccaagaacaccctgaaagaaagtagtcccgtttcccctttgcagatagagtct
gtgtctccaacagaaccagtttctgcctcagaaagcccaggagatggtcctgtggcccaa
ccaagccccaataatacgtcatcccaggattctcaaagtaacaactatcagaatcttcca
gtacaggacagaaacctgatgcttccggatggccccaaacctcaggaagatggctctttc
aagaggagatacccccgccgcagtgcccgggcacgctctaacatgttctttgggctcacc
ccactctatggagtaaggtcctatggcgaagaagacattccattttacagcagctcaact
gggaagaagcgaggcaagaggtccgctgaaggacaggtggacggggcagacgacctgagc
acttcagatgaagacgacttatactattacaacttctctaggacagtgatttcttcaggt
ggagaggaacggctgacaccccataatttatttcgggaggaagaacagtgtgatcttcca
aaaatctcacagttggatggcatcgacgatgggacagagagtgataccagcgtcacagcc
acaactcggaagagcagccagattccaaaaagaaacagtaaagaaaacggaacagagaac
ttgaagatggatcggcctgaagacactggggaaaaggaacatgtcattaagagctcagtt
ggccacaagaatgagccaaaggtggataactgccacgccgtgagcagagtgaaagcaccg
gggcaggactccctggaggctcagctcagctcgctggagtcgagccgcagggtccacaca
agcaccccttcagataaaaacttgctggacacctataacaccgagctcctgaagtcagat
tcggataacaacaacagtgacgactgtgggaacatcctgccctcggacattatggacttt
gtcctaaagaatactccgtccatgcaggctttgggtgagagcccagagtcctcttcgtca
gaactcctcaaccttggtgaaggcttgggtcttgacagcaatcgtgaaaaagacatgggt
ctttttgaagtgttttcccagcagttgccgacgacagagcctgtggacagtagtgtctct
tcctccatctcagcggaggagcagtttgagttgcccttagagctgccatcagatctctcc
gtcctgaccacccggagtcccacggtccctagccagaactccagtaggctagccgtgatc
tcagactcaggagagaagagagtaaccatcacagaaaaagcttcctctgaaggcgactcc
tccctgctgagtccaggagtagatcccagtcctgagggccacatgactcccgaccacttt
atccagggtcacatggatgcggaccacatctccagccctccctgtggctctgtggagcaa
ggtcatggcaacaatcaggacttaactagaaacagcaacacccctggccttcaggtaccc
gtttcccctactgttcccatccagaatcagaaatacgcgcccaactccactgacagtcct
ggcccgtctcagatttccaatgccgctgtccagaccactccgccccacctgaagccagcc
actgagaaactcattgttgttaaccagaacatgcagccactctacgtcctccaaaccctt
ccgaatggagtgacccagaaaatccagctgacctcgtctgtaagttcagcacccagtgtg
atggagacaaacacgtccgtgttgggccccatgggaagtggtctcaccctcaccacagga
ctcaacccgaacctgccagcctctcagtcgttgttccctcctgctaccaaaggcttgctc
cccatgtctcatcaccagcacttacattccttccccgccgctactcagagtagcttcccc
cccaacatcagcagtccttcgggcctactcatcggggttcagccttctccagacccccag
cttttggtttcagaagccagccagaggacagacctcagtaccacggtagccactccatcc
tctggactcaagaaaagacccatatctcgcctgcagacccgaaagaataagaaacttgcc
ccctctagtaccccttccaacattgccccttcagacgtggtttccaacatgacactgatt
aacttcactccctcccaacttccgaatcatcccaatctcttagacttggggtcactgaat
acttcatctcaccgaactgtccccaacatcataaaaaggtctaaatctggcattatgtat
tttgaacaggcacccctgctaccgcagagtgtgggggggaccactgccccggcggcaggc
actgccaccataagccaggataccagccacctcacgacagggcccgtgtctggcctggcc
tccagttcctccgtcctgaacgttgtatccatgcaaactaccaccgcccccacaagtagt
gcatctgttccaggacacgtcgcgttaaccaaccccaggttgctgggtaccccggatatc
ggctccataagcaatcttctaatcaaagccagccagcagagcctggggattcaagaccag
cctgtggctttaccgccaagttcgggaatgtttccaccactggggacgtcacagactccc
tccacgggcgcgatgacggctgcacccagcatctgtgtgctcccctctacccagacagcg
ggtgtcacagctgcttcgccttctggggaagcagaagaacactatcagctccaccatgtg
aaccagctcctcgccagcaaaactggggttctctcttcccaacgggatcttgattctgct
ccaggatcccagggatccagctttacccagacagtagatgctcctaatcccatgggcctg
gagcagaacaaggctttaccctcagctatgcaagccagctcagcctctccagggggttcc
ccatcctccggacagcggtcagcgagtccctcagtgccggggcccacgaaacccaaacca
aaaatcaaacggattcagctgcctttggacaaagggagtggcaagaagcacaaagtttcc
cacttgcggaccagttcttctgaagcacacattccagaccaagaagccaacacgacaccc
cagacctcagtcacagggactccaggagcagaggctgagccgcaggatacagctagtgtg
gagcagtcaccacagaaggagtgtgggcagcctgcagcgcaagtggctgctcttcctgag
attcagacaacacagaatccagcacatgaaccagaaaattcagaacctaaaacggcggaa
gaggaagaaagtaatttcagctctccactgatgctttggctccagcaagaacagaagcgg
aaagaaagcattgctgagaaaaagcccaagaaaggacttgtttttgaaatttcaagtgat
gatggctttcagatatgtgcagaaagtattgaagatgcctggaagtcgctgacagacaaa
gtccaggaggctcggtccaacgcccgcctgaagcagctctcatttgcaggtgtgaacggt
ttgcggatgctggggattctccatgacgctgttgtattcctgattgagcaactgtctggt
gccaagcactgtaggaattacaaattccgtttccacaaaccagaggaggccaatgagccc
ccactgaaccctcacggctcagccagggctgaagtccacctgaggaagtcagcctttgac
atgtttaacttcctggcttctaaacaccggcagcctcctgagtacaaccccaatgacgag
gaagaggaggaggtgcagctgaagtcagctcggagggcaactagtatggatctaccaatg
cccatgcgtttccggcacttaaaaaagacttctaaggaggcagttggtgtctacaggtct
cccatccacggccggggtcttttttgtaagagaaacattgatgcaggtgagatggtgatt
gagtatgctggcaacgtcatccgttccatccagactgacaagcgagagaagtactatgac
agcaagggcatcggctgctacatgttccggatcgatgactctgaggtggtggacgccacc
atgcacgggaacgccgcccgcttcatcaaccactcatgtgagcccaactgctactctcgg
gtcatcaacatcgacgggcagaagcacattgtcatcttcgccatgcgcaagatctaccga
ggggaggaactcacttacgactataaattccccattgaggacgccagcaacaagctcccc
tgcaactgtggtgccaagaaatgccggaagttcctaaactaa

DBGET integrated database retrieval system