KEGG   Bos taurus (cow): 508683Help
Entry
508683            CDS       T01008                                 

Gene name
PFKL
Definition
phosphofructokinase, liver (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bta  Bos taurus (cow)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:bta01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bta01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bta00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:bta00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bta00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bta00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 780 aa AA seqDB search
MASVDLEKLRTTGAGKAIGVLTSGGDAQGMNAAVRAVTRMGIYVGAKVFLIYEGYEGLVE
GGENIKQANWLSVSNIIQLGGTVIGSARCKAFTTREGRRAAAYNLVQRGITNLCVIGGDG
SLTGANIFRSEWGSLLEELVSEGKISEGTAQTYSHLNIAGLVGSIDNDFCGTDMTIGTDS
ALHRIMEVIDAITTTAQSHQRTFVLEVMGRHCGYLALVSALASGADWLFIPEAPPEDGWE
NFMCERLGETRSRGSRLNIIIIAEGAIDRNGKPISSRYVKDLVVQRLGFDTRVTVLGHVQ
RGGTPSAFDRILSSKMGMEAVMALLEATPDTPACVVSLSGNQSVRLPLMECVQMTKEVQK
AMDEKRFDEAIQLRGGSFENNWNIYKLLSHQKISKEKTNFSLAILNVGAPAAGMNAAVRS
AVRSGISQGHTVYVVHDGFEGLAKNQVQEVSWHDVAGWLGRGGSMLGTKRTLPKGFMEKI
VENIRLHNIHALLVIGGFEAYEGVLQLVEARGRYEELCIVMCVIPATISNNVPGTDFSLG
SDTAVNAAMESCDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAVGADAAYVFEDPFN
IQDLKANVEHMTEKMKTEIQRGLVLRNEKCHEHYTTEFLYNLYSSEGKGVFDCRTNVLGH
LQQGGAPTPFDRNYGTKLGVKAIIWMSEKLRAVYRNGRVFANASDSACVIGLQKKVVAFS
PVTELKKDTDFEHRMPREQWWLNLRLMLKMLAHYRISMADYVSGELEHVTRRTLSIETGF
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atggccagcgtggatctggagaagctgcggaccaccggggctggcaaggccatcggcgtg
ctgaccagtggcggtgatgcgcaaggcatgaatgccgctgtcagagccgtgactcgtatg
ggcatttacgtgggggccaaggtcttcctcatctacgagggctatgaaggcctcgtggag
ggcggcgagaacatcaagcaggccaactggctgagcgtctccaacatcatccagttgggc
ggcaccgtcatcggcagcgcccgctgcaaggccttcaccacgcgggagggacgccgggcg
gccgcctacaacctggtccagcgtggcatcaccaacctgtgcgtcatcggcggggacggc
agcctcactggggccaacatcttccgcagcgagtggggcagcctcctggaggagctggtg
agcgaaggcaagatctcagagggcacggctcagacctattcacacctgaacatcgcgggg
ctggtgggctccatcgacaatgacttctgtggcaccgacatgaccatcggcacagactcg
gcgctgcaccgcatcatggaagtcatcgacgccatcaccaccactgcccagagccaccag
aggacctttgtgctggaggtgatgggacggcactgcgggtacctggccctggtgtctgcc
ctggcctcgggggccgactggctgttcatccctgaggcgccccctgaggacggctgggag
aacttcatgtgtgagcggctcggcgagactcggagccgagggtcccgcctcaacattatc
atcattgctgagggcgccatcgaccgcaacgggaagcccatctcgtcccgctacgtgaag
gacctggtggtccagagactgggcttcgacacgcgtgtgactgtgctgggccacgtgcag
aggggagggaccccctcggcattcgaccgcatcctgagcagtaagatgggcatggaggcg
gtgatggcgctgctggaggccacgcccgacacgccggcctgcgtggtcagcctctcgggg
aaccagtccgtgcggctgcccctcatggagtgtgtgcagatgaccaaggaggtgcagaag
gccatggacgagaagaggtttgacgaggccatccagctccgaggcgggagctttgagaac
aactggaatatttacaagctgctttcccaccagaagatctccaaggagaagaccaacttc
tccctggccatcctgaacgtgggggccccagcagccggcatgaacgcggccgtgcgctcg
gcggtgcgttctggcatctcccagggccacacggtgtacgttgtgcatgacggctttgaa
ggcctggccaagaaccaggtgcaagaagtgagctggcatgacgtggccggctggctgggg
cgtggtggctccatgctggggacaaagaggacgctgcccaaaggcttcatggagaaaatt
gtggaaaacatccgccttcacaacatccacgccctgctggtcatcgggggctttgaggcc
tacgagggggtgctgcagctggtggaggcccgtgggcgctatgaggagctgtgcatcgtc
atgtgcgtcatccccgccaccatcagcaacaacgtgccaggcacggacttcagcctgggc
tccgacacggccgtcaacgccgccatggagagttgtgaccgcatcaagcagtcggcctcg
gggaccaagcgccgtgtgttcatcgtggagaccatgggtggctactgcggctacctggct
actgtgactggcattgctgtgggcgccgacgctgcctatgtcttcgaggatcccttcaac
attcaagacttaaaggccaatgtggagcacatgaccgagaagatgaagacagagatccag
cggggcctggtactccggaacgagaagtgccacgagcactacaccacagagttcctgtac
aacctctactcctccgagggcaagggcgtgtttgactgcaggaccaacgtcctgggccac
ctgcagcagggtggagctcccaccccctttgaccggaactatggtaccaagctcggggtg
aaagccataatctggatgtcggagaagctgcgggcagtctatcgcaatgggcgggtgttt
gccaatgcctctgactcggcctgcgtgattggcctgcagaagaaagtggtggccttcagc
cctgtcaccgagctcaagaaagacaccgactttgagcaccgcatgccccgggagcagtgg
tggctgaacctgcggctcatgctgaagatgctggcacactaccgcatcagcatggctgac
tacgtgtccggggagctggagcacgtcacccgccgcaccctcagcattgagacgggcttc
tga

DBGET integrated database retrieval system