KEGG   Bos taurus (cow): 508874Help
Entry
508874            CDS       T01008                                 

Gene name
PFN4
Definition
profilin family, member 4
Orthology
K05759  
profilin
Organism
bta  Bos taurus (cow)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    508874 (PFN4)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    508874 (PFN4)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    508874 (PFN4)
Exosome [BR:bta04147]
 Exosomal proteins
  Proteins found in most exosomes
   508874 (PFN4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
11
AA seq 129 aa AA seqDB search
MSHLQNLLLDTLLGTKHVDSAALIKLQERSLCVASPGFSVMPSDVRTLVNGFAKNPLKTR
REGLYFKEKDYKCVRADDYSLYAKNENTGVIVVKTHLYLLVATYSEGMYPSVCVEATEKL
GDYLRRKGN
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgagccatttgcagaacttactgttagatacactcctgggaacaaagcatgtggacagt
gcagccctcatcaaactccaggagcggagcctatgtgtagcatcaccaggatttagtgta
atgcccagtgatgtccgaacacttgtaaatgggtttgccaagaaccctttgaaaaccaga
agagaaggactgtatttcaaggagaaggactacaaatgtgtccgggcagatgactattct
ctttatgccaagaatgaaaacactggtgtgattgttgtgaagacccatctgtatcttctg
gtggcaacttactctgaaggcatgtatcctagtgtctgtgtggaagccacagagaagttg
ggagactatctaagaagaaaagggaattaa

DBGET integrated database retrieval system