KEGG   Bos taurus (cow): 508902Help
Entry
508902            CDS       T01008                                 

Gene name
USP28
Definition
ubiquitin specific peptidase 28 (EC:3.4.19.12)
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     508902 (USP28)
Peptidases [BR:bta01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   508902 (USP28)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
15
AA seq 1081 aa AA seqDB search
MTAELQQDDAAGATDRHGSSCQMLLNQLREITGIQDPSFLHEALKASNGDITQAVSLLTD
ERVKEPSQETAAEPSEEEGSAASKEELAKVIDLTHDSKDDLQAAIALSLLESPKIQADGR
DLNRMHEATSAETKRSKRKRCEVWGENPNPNDWRRVDGWPVGLKNVGNTCWFSAVIQSLF
QLPEFRRLVLSYSLPQNVLENCPSHTEKRNIVFMQELQYLFALMMGSNRKFVDPSAALDL
LKGAFRSPEEQQQDVSEFTHKLLDWLEDAFQLAVNVNNPRNKSENPMVQLFYGTFLTEGI
REGKPFCNNETFGQYPLQVNGYRNLDECLEGAMVEGDIELLPSDHSVKYGQERWFTKLPP
VLTFELSRFEFNQSLGQPEKIHNKLEFPQIIYMDRYMYRSKELVRSKRDCIRKLKEEIKI
LQQKLERYVKYGSGPARFPLPDMLKYVIEFASTKPASESSASQSDACMTEPLSSAHCLTS
DLTSKESTSEESTSQEAEGTFSSSEDSGRKSRMAEQPLKPPRSSVEMPAHPAPRTVTDEE
INFVKTCLQRWRNEIEQDIQDLKNSIASTTQTIEQMYCDPLLRQVPYRLHAVLVHEGQAN
AGHYWAYVYNQPRQVWLKYNDISVTESSWEELERDSYGGQRNVSAYCLMYINDKLPHFNA
EAAPNELDQMSGEVEALSVELKHYIQEDNWRFEQEVEEWEEEQSCKIPQMASSTSSASQD
FSPSQESSVASSHGARCLSSEHAVIVKEQTAQAIANTAHAYENSGVEAALSEVMLSPAMQ
GVILAIAKARQTFDRDGSEAGLIKAFHEEYSRLYQLAKETPTSHSDPRLQHVLIYFFQNE
APKRVVERTLLEQFADKNLSYDERSISIMKVAQAKLKEIGPDDMNMEEYKKWHEDYSLFR
KVSVYLLTGLELYQKGKYQEALSYLVYAYQSNATLLMKGPQRGVKESVIALYRRKCLLEL
NAKAASLFETNDEHSVTEGINVMNELIIPCIHLIINNDISKDDLDAIEVMRNHWCSYLGQ
DIAENLQLCLGEFLPRLLDPSAEIIVLKEPPTIRPNSPYDLCSRFAAVMESIQGVSAVTV
K
NT seq 3246 nt NT seq  +upstreamnt  +downstreamnt
atgactgcggagctgcagcaggacgacgcggccggagcgaccgaccgccacggctcgagc
tgccaaatgctgttaaatcaactgagagaaatcacaggcattcaggacccttcttttctt
catgaagctctgaaggccagtaatggtgacatcacccaggccgtcagccttctcactgat
gaaagagttaaagagcccagccaagagactgctgcagaaccatctgaagaagaggggagt
gctgccagcaaagaggaattagcaaaagtgatagaccttactcacgatagcaaggatgat
cttcaggctgccattgctttgagtctgctggagtcccccaaaattcaagctgatggaaga
gatcttaacaggatgcacgaggcaacctctgcagaaactaaacgctcaaagagaaaacgc
tgtgaagtctggggagaaaatcccaatcccaatgactggagacgagttgatggttggcca
gttgggctgaaaaatgttggcaatacatgttggtttagtgctgttattcagtctctgttt
caattgcctgaattccgaagacttgtcctcagctatagtctaccacagaacgtacttgaa
aattgtccaagtcacacggaaaagagaaatatcgtgtttatgcaggagcttcaatatttg
tttgctctgatgatgggatcaaatcgcaagtttgtcgacccttcagcagccctggacctc
ttaaagggagcgttccgatcccctgaggaacagcagcaagatgtgagtgagttcacacac
aagctcctggattggctggaggacgccttccagctagctgttaatgttaacaatcccagg
aacaaatctgaaaatccaatggtgcagctgttctatggtactttcctcacggaagggatt
cgtgaaggaaagcccttttgtaacaatgagaccttcggccagtatccccttcaggtaaac
ggttatcgtaacttagacgaatgtttagaaggggccatggtggagggtgacattgagctg
cttccttccgatcattcagtgaagtacggacaagagcgttggtttacaaagctacctcca
gtgttgacctttgaactctcaagatttgagttcaatcagtccctgggtcagccagagaaa
attcacaataagcttgaatttcctcagatcatttatatggacaggtatatgtacaggagc
aaagagcttgttcgaagtaagcgagattgtattcgaaaactcaaagaagaaataaaaatt
ctgcagcaaaaactggaaaggtatgtgaagtatggctcgggcccagcccggttcccgctt
ccggacatgttgaaatacgtgattgaatttgctagtacaaaacctgcctcagagagctct
gcatctcaaagtgatgcgtgcatgacagaaccactttcttcagcacactgcctgacttct
gatctgacatccaaggaaagtacaagtgaagagagcacgtctcaggaagctgaaggaacc
ttttcttcctctgaagattctggacgcaagtctaggatggcagagcagccacttaaacct
ccccgttcttccgtggaaatgcccgcacacccagctcctcgaacagtcacagatgaggag
ataaactttgttaagacctgcctgcagaggtggaggaacgagattgaacaggatatacaa
gacttaaagaacagtattgcaagcactacccagactattgagcagatgtactgtgatcct
ctcctccgtcaggtgccttatcgcttgcacgcggtcctcgttcacgaaggacaggcaaac
gcggggcactactgggcctacgtctataatcagccgcgacaagtctggctcaagtacaac
gacatctctgttactgagtcttcctgggaagaacttgaaagagattcctatgggggccag
agaaatgttagtgcttactgcctgatgtatattaacgacaagctgccccacttcaatgca
gaggcggccccaaatgaattagatcagatgtcaggagaagtagaagccctgtctgttgaa
cttaagcattacattcaggaagataactggaggtttgagcaggaagtggaggaatgggaa
gaagagcagtcttgtaaaattcctcagatggcatcttccaccagctcagcatcacaggac
ttctctccatctcaagaatcttcagtagcctcttcccacggggctcggtgcctgtcctct
gagcacgctgtgatcgtgaaggagcagactgcccaggcgattgcaaacacagcacatgcc
tatgagaacagtggcgtagaagctgcactgagtgaggtgatgctgagccctgccatgcaa
ggggtcatcctggccatagctaaagcccgtcagacctttgaccgagatgggtctgaagca
gggcttattaaggcattccatgaagagtactccaggctctatcagctcgccaaggagacc
cccacctctcacagtgatcctcgtcttcagcacgtgctcatctacttcttccaaaatgaa
gcgcctaaaagggtagtagagcggacccttctggaacaatttgccgataaaaaccttagc
tatgatgaaagatcgatcagtattatgaaggtggctcaagcaaaactgaaggagattggt
ccagatgacatgaatatggaagagtacaagaagtggcatgaagattacagtttgtttcga
aaggtgtctgtgtatctgctgacaggcctggaactctatcagaaaggaaagtaccaagaa
gcgctttcctacctggtgtatgcctaccaaagtaatgccactctgctgatgaaggggccc
cagcggggcgtaaaggagtcggtgatcgctttataccgaagaaaatgccttctggagctg
aatgccaaagcagcttctctctttgaaacaaatgatgagcactctgtaacagagggtatt
aatgtgatgaatgagctgatcattccctgtattcaccttatcattaataatgacatctcc
aaggatgacctggatgccattgaggtcatgagaaaccactggtgctcttaccttgggcag
gatatcgcagaaaatctgcagctgtgcttaggggagtttctacccagacttctagatcct
tctgcagaaatcattgtcttaaaggagcctccaactattcggcccaattctccctatgac
ctttgtagccgatttgcagctgtcatggagtcaattcaaggagtgtcagctgtgacagtg
aaataa

DBGET integrated database retrieval system