KEGG   Bos taurus (cow): 509329Help
Entry
509329            CDS       T01008                                 

Gene name
HAT1
Definition
histone acetyltransferase 1 (EC:2.3.1.48)
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
bta  Bos taurus (cow)
Pathway
Alcoholism
Brite
KEGG Orthology (KO) [BR:bta00001]
 Human Diseases
  Substance dependence
   05034 Alcoholism
    509329 (HAT1)
Enzymes [BR:bta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     509329 (HAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
2
AA seq 413 aa AA seqDB search
MEKFLVEYKSAVEKKLAEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLFGDDETA
FGYKGLKILLYYIAGSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFCTNTNDF
LSLLEKEADFKPFGTLLHTYSVLSPTGGENFTFQIYKADMTCRGFREYHERLQTFLMWFI
ETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILTP
FQGQGHGAQLLETVHRYYIASPSVLDITAEDPSKSYVKLRDFVLVKFCQDLPCFSREKLM
QGFSEDMAIEAQQKFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLISPYKKK
QRDLAKMRKCLRPEELTNQMNQIEISMQHEQLEESFQELVEDYRRVIERLAQE
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggagaagtttttggttgaatacaagagtgcagttgagaagaaactggctgagtacaaa
tgtaacaccaacacagcaattgaactgaaattagttcgttttcctgaagatcttgagaat
gacattagaactttctttcctgagtatacccatcaactctttggggatgatgaaactgct
tttggttacaagggtctgaagatcttgttatattatattgctggtagcctatcaacaatg
ttccgtgttgaatatgcatctaaagttgatgagaactttgactgtgtagaggcagatgat
gttgaggggaaaattagacaaatcattccacctggattttgcacaaacacaaatgatttt
ctttcgttgctggaaaaagaagctgatttcaagccatttggaaccttacttcacacatac
tctgttctcagtccaacaggaggagaaaactttacctttcagatttataaggctgacatg
acatgtagaggctttcgagaatatcatgaaaggcttcagacctttttgatgtggtttatt
gaaactgctagctttattgacgtggatgatgaaagatggcactactttctagtatttgag
aagtataataaggatggagctacactctttgcgaccgtaggctacatgacagtctataat
tactatgtgtacccagacaaaacccggccacgtgtaagtcaaatgctgatattgactcca
tttcaaggtcaaggccatggtgctcaacttcttgaaacagttcatagatactacattgca
tctccttctgttcttgatattacagcggaagatccatccaaaagctatgtgaaattgaga
gactttgtgcttgtgaagttttgtcaagatttgccctgtttttcccgggaaaagttaatg
caaggattcagtgaagatatggcaatagaggctcaacagaagttcaaaataaataagcaa
catgctagacgggtttatgaaattcttcgactactggtaactgacatgagtgatgctgaa
caatacagaagctatagactggatattaaaagaagactaattagcccatataagaaaaaa
cagagagatcttgctaaaatgagaaaatgtctcagaccggaagaactgacaaaccagatg
aaccagatagaaataagcatgcaacatgaacagctggaagaaagctttcaggaactcgtg
gaagattatcgacgtgtcattgaacgcctcgctcaagagtag

DBGET integrated database retrieval system