KEGG   Bos taurus (cow): 509694Help
Entry
509694            CDS       T01008                                 

Gene name
USP22
Definition
ubiquitin specific peptidase 22 (EC:3.4.19.12)
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     509694 (USP22)
Peptidases [BR:bta01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   509694 (USP22)
Transcription machinery [BR:bta03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     509694 (USP22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
19
AA seq 514 aa AA seqDB search
MDAELVVTPPGCAHLGSFKVDNWKQNLRAIYQCFVWSGSAEARKRKAKSCVCHVCGLHLN
RLHSCLHCVFFGCFTKKHIHEHAKSKRHNLAIELMYGGIYCFLCQDYIYDKDIEIIAKEE
QRKAWKMQGVGEKFSTWEPTKRELELLKHNPKRRKITSNCTIGLRGLINLGNTCFMNCIV
QALTHTPLLRDFFLSDRHRCEMQSPSSCLVCEMSSLFQEFYSGHRSPHIPYKLLHLVWTH
ARHLAGYEQQDAHEFLIAALDVLHRHCKGDDNGKKANNPNHCNCIIDQIFTGGLQSDVTC
QVCHGVSTTIDPFWDISLDLPGSSTPFWPLSPGSESSVVNGESHVSGTTTLTDCLRRFTR
PEHLGSSAKIKCSGCHSYQESTKQLTMKKLPIVACFHLKRFEHSAKLRRKITTYVSFPLE
LDMTPFMASSKESRMNGQYQQPTDSLNNDNKYSLFAVVNHQGTLESGHYTSFIRQHKDQW
FKCDDAIITKASIADVLDSEGYLLFYHKQFLEYE
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggacgcggagctcgtggtgacgccgccgggctgcgcgcacctgggcagcttcaaggtg
gacaactggaagcagaacctgcgcgccatctaccagtgcttcgtgtggagcggctcagcc
gaggcccgcaagcggaaggcgaagtcgtgcgtatgtcatgtgtgtggcctccacctgaat
cggctgcactcctgcctccactgtgtcttcttcggctgtttcacaaagaagcacattcat
gagcacgccaagtccaagaggcacaacctggccatcgagctcatgtacggaggtatctac
tgctttttgtgtcaggactacatttatgacaaagacatagaaatcattgccaaagaggag
cagcggaaagcttggaagatgcaaggtgtcggggagaagttttcaacatgggagccgacc
aaacgggagctcgagttgctgaaacacaaccccaagcggcggaagatcacgtccaactgc
actattggtctgcgcggcctcatcaacctggggaacacgtgcttcatgaactgcatcgtg
caggcgctcacgcacacgcccctgctgcgcgacttcttcctgtccgaccggcaccgctgt
gagatgcagagccccagctcctgcctggtctgcgagatgtcctccctgttccaggagttc
tactcggggcaccgttccccccacatcccatacaaactgctgcacctcgtgtggactcac
gcccggcacctggcaggctacgagcagcaggacgcacacgagttcctcatcgcagccctg
gatgtcctgcaccggcactgcaaaggtgacgataacggaaagaaggccaacaaccccaac
cactgcaactgtatcatagaccagattttcacaggagggctgcagtctgacgtcacctgc
caggtgtgccatggggtttccaccaccatcgaccccttctgggacatcagcctggacctc
cctggctcttccacacccttctggccgctgagccctggaagcgagagcagtgtggtaaat
ggggagagccacgtgtcaggaaccacgaccctcaccgactgcctgcggagatttaccaga
ccagagcacttaggaagcagtgccaagatcaaatgcagcggttgccatagctaccaggag
tccaccaagcagctcaccatgaagaagctgcccattgtggcctgcttccacctcaaacgg
tttgaacactcagccaaactccggcgtaagatcaccacctacgtgtccttccccctggag
ctggacatgacccccttcatggcctccagcaaagagagcaggatgaacggacagtaccag
cagccgacagacagtctcaacaatgacaacaagtactcgttgtttgcggtggtcaaccac
caggggaccctggagagcggccactacaccagcttcatccgacagcacaaggaccagtgg
ttcaaatgtgatgacgccatcatcaccaaggccagcatcgcggacgtgctggacagcgag
gggtacttgctgttctaccacaagcagttcctggagtacgagtag

DBGET integrated database retrieval system