KEGG   Bos taurus (cow): 509744Help
Entry
509744            CDS       T01008                                 

Gene name
ADH1C, ADH3
Definition
(RefSeq) alcohol dehydrogenase 1C (class I), gamma polypeptide
  KO
K13951  alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
bta  Bos taurus (cow)
Pathway
bta00010  Glycolysis / Gluconeogenesis
bta00071  Fatty acid degradation
bta00350  Tyrosine metabolism
bta00830  Retinol metabolism
bta00980  Metabolism of xenobiotics by cytochrome P450
bta00982  Drug metabolism - cytochrome P450
bta01100  Metabolic pathways
bta05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    509744 (ADH1C)
  Lipid metabolism
   00071 Fatty acid degradation
    509744 (ADH1C)
  Amino acid metabolism
   00350 Tyrosine metabolism
    509744 (ADH1C)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    509744 (ADH1C)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    509744 (ADH1C)
   00982 Drug metabolism - cytochrome P450
    509744 (ADH1C)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    509744 (ADH1C)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     509744 (ADH1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 UDPG_MGDP_dh_N 2-Hacid_dh_C TrkA_N
Motif
Other DBs
NCBI-GeneID: 509744
NCBI-ProteinID: NP_001193316
BGD-bta: BT11948
UniProt: Q2T9S5
Position
6
AA seq 375 aa AA seqDB search
MSTAGKVIKCKAAVLWELNKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVNGSLVT
RLPVVLGHEGAGIVESIGEGVTTVRPGDKVIPLFIPQCGKCNVCKHPEANLCLKFQLKEP
RGTLNDGTCRFTCRGKPIHHFLGTSTFTQYTVVDEMSVAKIHADSPLEKVCLIGCGFSTG
YGSAVKIAKVTQGSTCAVFGLGGVGLSVIMGCKAAGAARIIAVDINKDKFARAKQVGATE
CINPQDYEKPIEEVLKEVSGGGVDFSFEVIGRLDTMMSALLCCQEAYGVSVIVGVPPHAQ
NISMNPMLLLTGRTWKGAIFGGFKSKESVPKLVTDFMAKKFSLDQLITHVLPLEKINEGF
DLLRSGMSVRTILTF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggcaggaaaagtaataaaatgcaaagcagctgtgctgtgggagctcaataaa
ccattttccattgaggaggtggaggttgcaccccctaaggcccatgaagttcgtattaag
atggtggccacaggaatctgtcgctcagatgaccatgtggttaatggatctctggtcaca
cgtcttcctgtggtcttaggtcatgagggagccggcattgtggagagcattggagaaggg
gtgactacagtaagaccaggtgataaagtcatcccactctttattccccagtgtggaaag
tgcaatgtttgtaaacacccagaagccaacctttgcctgaaattccagctgaaggagcct
cgggggacccttaatgatggtacctgcaggttcacctgcagggggaagcccatccaccac
ttcctcggcaccagcaccttcacccagtacacagtggtggatgagatgtcagtggccaag
atccatgcagactcaccactggagaaagtctgtctcattggctgcggattttctactggt
tatgggtctgcagtcaaaattgccaaggtcacccagggctccacctgtgccgtgtttggc
cttggaggagttggcctgtctgttatcatgggctgcaaagcagctggagcagccaggatc
attgcagtggacatcaacaaagacaaatttgcaagggccaaacaggtgggtgccacggag
tgcatcaaccctcaggactacgagaaacccatcgaggaggtgctgaaagaagtgagtggt
ggaggtgtagatttttcatttgaagtcatcggtcggcttgacaccatgatgtctgccttg
ctgtgctgtcaagaagcatatggtgtaagcgtcattgtaggagtacctcctcatgcccaa
aatatctctatgaaccccatgttgctgttgactggacgtacctggaaaggagctattttt
ggtggcttcaaaagtaaagaatctgtccccaaacttgtgactgatttcatggctaagaag
ttttcactggatcagttaattacccatgttttaccacttgaaaaaataaacgaaggattt
gacctgcttcgctctggaatgagtgtccgtaccatcctgacattttga

DBGET integrated database retrieval system