KEGG   Bos taurus (cow): 509744Help
Entry
509744            CDS       T01008                                 

Gene name
ADH1C, ADH3
Definition
alcohol dehydrogenase 1C (class I), gamma polypeptide
Orthology
K13951  
alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
bta  Bos taurus (cow)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    509744 (ADH1C)
  Lipid metabolism
   00071 Fatty acid degradation
    509744 (ADH1C)
  Amino acid metabolism
   00350 Tyrosine metabolism
    509744 (ADH1C)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    509744 (ADH1C)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    509744 (ADH1C)
   00982 Drug metabolism - cytochrome P450
    509744 (ADH1C)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    509744 (ADH1C)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     509744 (ADH1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
UniProt: 
Position
6
AA seq 375 aa AA seqDB search
MSTAGKVIKCKAAVLWELNKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVNGSLVT
RLPVVLGHEGAGIVESIGEGVTTVRPGDKVIPLFIPQCGKCNVCKHPEANLCLKFQLKEP
RGTLNDGTCRFTCRGKPIHHFLGTSTFTQYTVVDEMSVAKIHADSPLEKVCLIGCGFSTG
YGSAVKIAKVTQGSTCAVFGLGGVGLSVIMGCKAAGAARIIAVDINKDKFARAKQVGATE
CINPQDYEKPIEEVLKEVSGGGVDFSFEVIGRLDTMMSALLCCQEAYGVSVIVGVPPHAQ
NISMNPMLLLTGRTWKGAIFGGFKSKESVPKLVTDFMAKKFSLDQLITHVLPLEKINEGF
DLLRSGMSVRTILTF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggcaggaaaagtaataaaatgcaaagcagctgtgctgtgggagctcaataaa
ccattttccattgaggaggtggaggttgcaccccctaaggcccatgaagttcgtattaag
atggtggccacaggaatctgtcgctcagatgaccatgtggttaatggatctctggtcaca
cgtcttcctgtggtcttaggtcatgagggagccggcattgtggagagcattggagaaggg
gtgactacagtaagaccaggtgataaagtcatcccactctttattccccagtgtggaaag
tgcaatgtttgtaaacacccagaagccaacctttgcctgaaattccagctgaaggagcct
cgggggacccttaatgatggtacctgcaggttcacctgcagggggaagcccatccaccac
ttcctcggcaccagcaccttcacccagtacacagtggtggatgagatgtcagtggccaag
atccatgcagactcaccactggagaaagtctgtctcattggctgcggattttctactggt
tatgggtctgcagtcaaaattgccaaggtcacccagggctccacctgtgccgtgtttggc
cttggaggagttggcctgtctgttatcatgggctgcaaagcagctggagcagccaggatc
attgcagtggacatcaacaaagacaaatttgcaagggccaaacaggtgggtgccacggag
tgcatcaaccctcaggactacgagaaacccatcgaggaggtgctgaaagaagtgagtggt
ggaggtgtagatttttcatttgaagtcatcggtcggcttgacaccatgatgtctgccttg
ctgtgctgtcaagaagcatatggtgtaagcgtcattgtaggagtacctcctcatgcccaa
aatatctctatgaaccccatgttgctgttgactggacgtacctggaaaggagctattttt
ggtggcttcaaaagtaaagaatctgtccccaaacttgtgactgatttcatggctaagaag
ttttcactggatcagttaattacccatgttttaccacttgaaaaaataaacgaaggattt
gacctgcttcgctctggaatgagtgtccgtaccatcctgacattttga

DBGET integrated database retrieval system