KEGG   Bos taurus (cow): 509936Help
Entry
509936            CDS       T01008                                 

Gene name
ADCY6
Definition
(RefSeq) adenylate cyclase 6
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
bta  Bos taurus (cow)
Pathway
bta00230  Purine metabolism
bta01522  Endocrine resistance
bta04015  Rap1 signaling pathway
bta04022  cGMP-PKG signaling pathway
bta04024  cAMP signaling pathway
bta04062  Chemokine signaling pathway
bta04072  Phospholipase D signaling pathway
bta04114  Oocyte meiosis
bta04211  Longevity regulating pathway
bta04213  Longevity regulating pathway - multiple species
bta04261  Adrenergic signaling in cardiomyocytes
bta04270  Vascular smooth muscle contraction
bta04371  Apelin signaling pathway
bta04540  Gap junction
bta04611  Platelet activation
bta04713  Circadian entrainment
bta04714  Thermogenesis
bta04723  Retrograde endocannabinoid signaling
bta04724  Glutamatergic synapse
bta04725  Cholinergic synapse
bta04727  GABAergic synapse
bta04742  Taste transduction
bta04750  Inflammatory mediator regulation of TRP channels
bta04911  Insulin secretion
bta04912  GnRH signaling pathway
bta04913  Ovarian steroidogenesis
bta04914  Progesterone-mediated oocyte maturation
bta04915  Estrogen signaling pathway
bta04916  Melanogenesis
bta04918  Thyroid hormone synthesis
bta04921  Oxytocin signaling pathway
bta04923  Regulation of lipolysis in adipocytes
bta04924  Renin secretion
bta04925  Aldosterone synthesis and secretion
bta04926  Relaxin signaling pathway
bta04927  Cortisol synthesis and secretion
bta04928  Parathyroid hormone synthesis, secretion and action
bta04934  Cushing's syndrome
bta04961  Endocrine and other factor-regulated calcium reabsorption
bta04962  Vasopressin-regulated water reabsorption
bta04970  Salivary secretion
bta04971  Gastric acid secretion
bta04972  Pancreatic secretion
bta04976  Bile secretion
bta05032  Morphine addiction
bta05166  HTLV-I infection
bta05200  Pathways in cancer
bta05414  Dilated cardiomyopathy (DCM)
Module
bta_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    509936 (ADCY6)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    509936 (ADCY6)
   04371 Apelin signaling pathway
    509936 (ADCY6)
   04072 Phospholipase D signaling pathway
    509936 (ADCY6)
   04024 cAMP signaling pathway
    509936 (ADCY6)
   04022 cGMP - PKG signaling pathway
    509936 (ADCY6)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    509936 (ADCY6)
  Cellular community - eukaryotes
   04540 Gap junction
    509936 (ADCY6)
 Organismal Systems
  Immune system
   04611 Platelet activation
    509936 (ADCY6)
   04062 Chemokine signaling pathway
    509936 (ADCY6)
  Endocrine system
   04911 Insulin secretion
    509936 (ADCY6)
   04923 Regulation of lipolysis in adipocyte
    509936 (ADCY6)
   04912 GnRH signaling pathway
    509936 (ADCY6)
   04913 Ovarian Steroidogenesis
    509936 (ADCY6)
   04915 Estrogen signaling pathway
    509936 (ADCY6)
   04914 Progesterone-mediated oocyte maturation
    509936 (ADCY6)
   04921 Oxytocin signaling pathway
    509936 (ADCY6)
   04926 Relaxin signaling pathway
    509936 (ADCY6)
   04918 Thyroid hormone synthesis
    509936 (ADCY6)
   04928 Parathyroid hormone synthesis, secretion and action
    509936 (ADCY6)
   04916 Melanogenesis
    509936 (ADCY6)
   04924 Renin secretion
    509936 (ADCY6)
   04925 Aldosterone synthesis and secretion
    509936 (ADCY6)
   04927 Cortisol synthesis and secretion
    509936 (ADCY6)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    509936 (ADCY6)
   04270 Vascular smooth muscle contraction
    509936 (ADCY6)
  Digestive system
   04970 Salivary secretion
    509936 (ADCY6)
   04971 Gastric acid secretion
    509936 (ADCY6)
   04972 Pancreatic secretion
    509936 (ADCY6)
   04976 Bile secretion
    509936 (ADCY6)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    509936 (ADCY6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    509936 (ADCY6)
  Nervous system
   04724 Glutamatergic synapse
    509936 (ADCY6)
   04727 GABAergic synapse
    509936 (ADCY6)
   04725 Cholinergic synapse
    509936 (ADCY6)
   04723 Retrograde endocannabinoid signaling
    509936 (ADCY6)
  Sensory system
   04742 Taste transduction
    509936 (ADCY6)
   04750 Inflammatory mediator regulation of TRP channels
    509936 (ADCY6)
  Aging
   04211 Longevity regulating pathway - mammal
    509936 (ADCY6)
   04213 Longevity regulating pathway - multiple species
    509936 (ADCY6)
  Environmental adaptation
   04713 Circadian entrainment
    509936 (ADCY6)
   04714 Thermogenesis
    509936 (ADCY6)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    509936 (ADCY6)
  Substance dependence
   05032 Morphine addiction
    509936 (ADCY6)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    509936 (ADCY6)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    509936 (ADCY6)
  Infectious diseases
   05166 HTLV-I infection
    509936 (ADCY6)
  Drug resistance
   01522 Endocrine resistance
    509936 (ADCY6)
Enzymes [BR:bta01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     509936 (ADCY6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA
Motif
Other DBs
NCBI-GeneID: 509936
NCBI-ProteinID: NP_001137349
BGD-bta: BT15041
Ensembl: ENSBTAG00000005464
UniProt: E1B9K3
Position
5
AA seq 1166 aa AA seqDB search
MSWFSGLLVPKVDERKTAWGERNGQQRPRRGTRTSGFCTPRYMSCLQGAQPPSPTPATAP
RCPWQDEAFIRRGGPGKGPELGLRAVALGFEDPEVAGAVGAAEVAPAVATRSRQACWRQL
VQVFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAALVLLTAVLLAFHAAPARPQPAYVA
LLACAATLFVALMVVCNRHSFRQDSMWVVSYVVLGILAAVQVGGALAADPRSPSAGLWCP
VFFVYITYTLLPIRMRAAVFSGLGLSTLHLVLAWQLNRGDAFLWKQLGANMLLFLCTNVI
GICTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKK
EDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLR
IKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHC
GVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNAYL
KEQHIETFLILGASQKRKEEKAMLAKLQRARANSMEGLMPRWVPDRAFSRTKDSKAFRQM
GIDDSSKDNRGAQDALNPEDEVDEFLGRAIDARSIDQLRKDHVRRFLLTFQREDLEKKYS
RKVDPRFGAYVACALLVFCFICFIQLVVFPRSALMLGIHASIFLLLLVTVLTCAVYSCGS
LFPEALQRVSRSIVRSRAHSTAVGIFSVLLVFTSAVASMFTCNHTPLRTCAARMLNLTPA
DITACHLQQLNYSLGLDAPLCEGTAPTCSFPEYFIGNVLLSLLASSVFLHISSIGKLAMI
FVLGLVYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKYMTPVIL
LVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHFLA
RERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEE
RFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADYAMRLMEQMKHINEHSFNNFQ
MKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKGYQ
LECRGVVKVKGKGEMTTYFLNGGPRS
NT seq 3501 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggtttagcggcctcttggtccccaaggtggatgaacggaaaacagcctggggg
gagcgcaatgggcagcagcggccgcgccgtgggacccgcaccagtggcttctgcacgccc
cgctacatgagctgcctccagggtgcgcagccacccagtccgacgcccgccactgcccct
cggtgcccctggcaggatgaggccttcatccggagggggggcccaggcaagggcccggag
ctggggctgcgggcggtggccctgggcttcgaggaccctgaggtggccggggctgtcgga
gcagcggaggtggcgcctgccgtggctaccaggagcaggcaggcctgctggcggcagctg
gtgcaggtgttccagtcgaagcagttccgctcggccaagctggagcgcctgtaccagcgc
tacttcttccagatgaaccagagcagcctgacgctgctcatggcggcgctcgtgctgctc
acggcagtgctgctggccttccacgcagcgcctgcccgccctcagcccgcctacgtggcc
ctgctggcctgtgccgccaccctcttcgtggcactcatggtggtgtgcaaccggcacagc
ttccgccaggactccatgtgggtggtgagctacgtggtgctgggcatcctggcggccgtg
caggtcgggggcgccctggcagccgacccgcgtagtccgtctgcaggcctctggtgccct
gtgttctttgtctacatcacctacacactccttcccatccgtatgcgggctgcagtcttc
agcggcctgggcctctccaccctgcacttggtcttggcctggcagctcaaccgtggtgac
gccttcctctggaagcagcttggagccaacatgctgctgttcctctgcaccaatgtcatt
ggcatctgcacacactatccggctgaggtgtctcagcgccaggcatttcaagagacccgc
ggttacatccaggcccggctgcacctgcagcatgagaaccggcagcaggagcggctgctg
ctgtctgtgttgccccagcatgttgccatggagatgaaagaagacatcaacacaaagaaa
gaagacatgatgtttcataagatctacatccagaagcacgacaatgtcagcatcctgttt
gcggacattgaaggcttcaccagcctggcgtcccagtgcacagcgcaggagctggtcatg
accctgaacgagctctttgcccggttcgacaagctggctgcggaaaatcactgcctgagg
atcaagatcttaggggactgttactactgcgtgtcagggctgccagaggcccgggcagac
catgcccactgctgcgtggagatgggggtggacatgatcgaggctatctcgctggtgcgc
gaggtgacaggtgtaaacgtgaacatgcgcgtgggcatccacagcgggcgggtgcactgt
ggcgtccttggcttgcggaaatggcagtttgatgtgtggtccaatgacgtgactctggcc
aaccacatggaggccgggggccgggccggccgcatccacatcacccgggccacgctgcag
tacctgaatggggactacgaagtggagccgggccgcggtggggagcgcaacgcctacctc
aaggagcagcacattgagaccttcctcatcctgggagccagccagaaacggaaggaagag
aaggccatgctggccaagctgcagcgggcacgggccaactccatggaagggctgatgcca
cgctgggtgcctgaccgtgccttctcccggaccaaggactccaaggctttccgccagatg
ggcatcgatgattccagcaaagacaaccggggtgctcaggatgccctgaaccctgaggat
gaggtagacgagttcctgggccgggccattgatgcccgcagcattgatcagctgcgcaag
gaccatgtgcgccggttcctgctcaccttccagagagaggatcttgaaaagaagtactca
cgcaaggtggacccccgctttggagcctacgtggcctgtgccctgctggtcttctgcttc
atctgcttcatccagcttgttgtcttcccacgctcagctctgatgcttgggatccacgcc
agtatcttcctgctgttactggtcaccgtgctgacttgtgccgtgtactcctgtggctct
ctgttccctgaggccctgcaacgtgtatctcgcagtattgtccgctcgagggcacatagc
accgcagttggcatcttttctgtcctgcttgtgttcacctccgccgttgccagcatgttc
acctgtaaccacacccccttacgaacttgcgcagcccggatgctgaatttaacccctgct
gacattaccgcctgccacctgcagcagctcaattactctctgggcctggatgctcccctg
tgtgagggcaccgcacccacctgcagcttccctgagtacttcattgggaacgtgttgctg
agtctcttggccagctctgtcttcctgcacatcagtagtatcgggaagttggccatgatc
tttgtcctggggctcgtttatctggtgctgcttctgctgggtcccccagccaccatcttt
gacaactatgacctcctgctgggcgtccacggcttggcttcttccaatgagacctttgat
gggctggactgcccagcggccgggagggtggcactcaaatacatgacccccgtgattctg
ctggtgtttgcactggcgctgtacctgcatgcccagcaggtggagtccaccgcccgcctg
gacttcctctggaagctgcaggcaacaggggagaaggaagagatggaggagctccaggcc
tacaaccggcggctgctacataacattctgcccaaggacgtggccgcccacttcctggcc
cgggagcgccggaacgacgagctctactatcagtcctgtgaatgtgtggccgtcatgttt
gcctccattgccaacttctctgagttctacgtggagctggaggccaacaacgagggtgtt
gagtgcctgcgactgctcaatgagatcattgctgatttcgatgagatcatcagtgaggag
cgcttccggcagctggagaagatcaagacaattggtagcacctacatggctgcctctggg
ctgaacgccagcacctatgatcaggtgggccgctcccacatcactgccctcgccgactat
gccatgcggctcatggagcagatgaagcacatcaatgagcactccttcaacaatttccag
atgaagatcggactgaacatgggcccagttgtggcaggcgtcattggggctcggaagcca
cagtatgacatctgggggaacacagtgaatgtctcgagtcgaatggacagcaccggggtc
cccgaccgaatccaggtgaccacggacctgtaccaggttctagcggccaagggctaccag
ctggaatgtcgaggggtggtcaaggtgaagggcaagggggagatgaccacctacttcctc
aatgggggccccaggagttag

DBGET integrated database retrieval system