KEGG   Bos taurus (cow): 510039Help
Entry
510039            CDS       T01008                                 

Gene name
CPB1, pCPB
Definition
carboxypeptidase B1 (tissue) (EC:3.4.17.2)
Orthology
K01291  
carboxypeptidase B [EC:3.4.17.2]
Organism
bta  Bos taurus (cow)
Pathway
Pancreatic secretion
Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:bta00001]
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    510039 (CPB1)
   04974 Protein digestion and absorption
    510039 (CPB1)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.2  carboxypeptidase B
     510039 (CPB1)
Peptidases [BR:bta01002]
 Metallo Peptidases
  Family M14: carboxypeptidase A family
   510039 (CPB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
1
AA seq 417 aa AA seqDB search
MLAFLILVTVTLASAHHSGEHFEGDKVFRVHVEDENHISLLHELASTRQMDFWKPDSVTQ
VKPHSTVDFRVKAEDTVAVEDFLGQNGLRYEVLISNLRSMLEAQFDSRVRTTGHSYEKYN
NWETIEAWTEQVASGNPDLISRSAIGTTFLGNTIYLLKVGKPGSNKPAVFMDCGFHAREW
ISPAFCQWFVREAVRTYGREIHMTEFLDKLDFYVLPVVNIDGYIYTWTTNRMWRKTRSTR
AGSSCTGTDLNRNFDAGWCSIGASNNPCSETYCGSAAESEKESKAVADFIRNHLSSIKAY
LTIHSYSQMMLYPYSYDYKLPKNNVELNTLAKGAVKKLASLHGTTYTYGPGASTIYPASG
GSDDWAYDQGIKYSFTFELRDKGRYGFVLPESQIQPTCEETMLAIKYVTSYVLEHLY
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgttggcgttcctgattctcgtgactgtgaccctagcatctgctcatcattctggtgag
cactttgaaggtgacaaggtgttccgtgtccatgttgaagatgaaaatcacatcagctta
ctccatgagttggccagcaccaggcagatggatttctggaaaccagattcggtcacacaa
gtcaaacctcacagtacagtggacttccgtgttaaagcagaagatactgtcgctgtggaa
gactttctggggcagaacggactacgatatgaggtattgataagcaacctgagatccatg
ctggaggctcagtttgatagtagagtccgcactactggacacagttacgagaagtacaac
aattgggaaacgatagaggcatggactgaacaagtcgccagtggaaatccagacctcatc
tctcgcagtgccatcggaactacatttttaggaaacactatatacctcctcaaggttggc
aaacctggatcaaataagcctgccgttttcatggactgcggtttccatgccagagagtgg
atttcccctgcattttgccagtggtttgtcagagaggctgttcggacctatggacgtgag
atccacatgacagaatttctcgacaagctagacttttatgtcttgcctgtggtcaatatt
gacggctacatctacacctggaccacgaaccgaatgtggaggaagacccgctccaccaga
gctggatctagttgcactggcacagacctcaacagaaattttgatgctggttggtgtagt
attggagcctctaacaacccctgttctgaaacttactgtggatctgctgcagagtctgaa
aaagagagcaaggctgtggctgatttcatccgcaaccacctctcttccatcaaagcatat
ctgacaatccactcttactctcagatgatgctctatccttactcctatgattacaaactc
cccaagaacaacgttgagttgaacaccctagctaaaggtgccgtgaaaaaactggcctca
ctgcatggtaccacgtacacctatggcccaggagcttcaacaatctatcctgcttctggg
ggctctgatgactgggcttatgaccaaggaatcaaatattccttcacatttgaactccgg
gataaaggcagatatggctttgtcctccctgaatcccagatccagccaacctgtgaggag
acaatgctggccatcaaatacgttaccagctatgtcctggaacatctgtactga

  All links  
No link information was found.   
DBGET integrated database retrieval system