KEGG   Bos taurus (cow): 510164Help
Entry
510164            CDS       T01008                                 

Gene name
USP10
Definition
ubiquitin specific peptidase 10 (EC:3.4.19.12)
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
bta  Bos taurus (cow)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
18
AA seq 800 aa AA seqDB search
MALRSPQYIFGDFSPDEFNQFFVTPRASVELPPYGGTVLCGAQAADDLPDGHDYQRIEFG
VNEVIEPSDTLPRTPNYSISSTLNPQAPEFILSCTTSKKLPDDIDKEVNYSSANCQYPGP
ALALDGGSPAEAEALENDGVSGGLGQRERKKKKKRPPGYYSYLKDGGEGGPSAEALVNGH
AGPAVSNSVGAEDTDLMGDVPTAGTPRTWGSPQDATDFVSDAGPAGAFPGALDGGARTAG
QLEGCPGADSEASCLPAEAGRDTLLRTAVAQPSVGTDTTENLGVTNGQILESLGEGTAAN
GVELHTVESSDSDPAKAESAPPPADAPASAAGTVPASQPAKSWASLFHDSKPSSSSLPVV
SVETKYSPPATSPLVSEKQAEVKEGLVPVSEDPVAIKIAELLENVTLIHKPVSLQPRGLI
NKGNWCYINATLQALVACPPMYHLMKLIPLYSKVQRPCTSTPMIDSFVRLMNEFTNMPVP
PKPRQALGDKIVRDIRPGAAFEPTYIYRLLTVIKSSLSEKGRQEDAEEYLGFILNGLHEE
MLNLKKLLSPNNDKLTISNGPKSHSVNEDEQEEPGEGSEDEWEQVGPRNKTSVTRQADFV
QTPITGIFGGHIRSVVYQQSSKESATLQPFFTLQLDIQSDKIRTVQDALESLVARESVQG
YTTKTRQEVEISRRVTLEKLPPVLVLHLKRFVYEKTGGCQKLIKNIEYPVDLEISKELLS
PGVKNKNFKCHRTYRLFAVVYHHGSSATGGHYTTDVFQIGLNGWLRIDDQTVKVVSQQQV
VRPAAERTAYLLYYRRVDLL
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atggccctccgcagcccgcagtatatttttggagattttagccctgatgaattcaatcag
ttctttgtgactcctcgtgcttcagttgagcttcctccatacggcgggacagttctgtgt
ggcgcacaggctgctgatgacctccccgatggacacgactatcagagaattgaatttggt
gttaatgaagtaattgaacccagtgacactctgccgagaactcccaactacagtatttca
agcacattgaaccctcaggcccctgaatttatccttagctgcacaacttccaaaaagctc
cccgatgacattgataaagaagtgaactatagctccgccaattgccagtacccgggccct
gcccttgccctggatggcggctctcctgccgaggcggaagctttagagaatgatggtgtt
tcgggtggtcttggacaaagggaacgtaaaaagaagaaaaaacgtccccctggatattac
agttacttgaaagacggtggcgagggtggaccttcggcggaagccctggtcaatggccat
gccggcccagcagtctccaacagcgtaggcgccgaggacacggacttgatgggggatgta
cccacggcagggaccccccggacttggggcagccctcaggacgccacggactttgtcagc
gacgccgggcctgctggggctttccctggagccctggacggcggggccaggactgcaggg
cagcttgagggctgccccggggctgactcagaggcctcctgcctccctgccgaggccggc
agggacaccttgttgaggacagctgtggctcagccctccgtggggactgatactactgag
aaccttggagtcactaacggacaaatacttgaatccttgggtgagggcacagctgccaac
ggggtggagttgcacaccgtggagagctcggactcggaccccgccaaggccgagagcgcc
ccaccacctgcggatgccccggcctccgcagcgggcactgtgcctgccagtcagcctgcc
aagtcgtgggctagtctttttcatgattctaagccttcttcctcttccttgcctgtggtt
tctgtggaaactaagtattcccctcccgccacgtctcccctggtctctgaaaagcaggcg
gaagtcaaggaagggctggttccagtttcagaggatcctgtagccataaagattgcagag
ttactggagaatgtcaccctgattcacaaaccggtgtcattgcaaccccgcgggctgatc
aacaaaggaaactggtgctacatcaatgctacactgcaagccttggtggcttgcccgccg
atgtatcacctgatgaagctcattcctctgtattcgaaagtgcaaaggccttgtacgtcc
acacccatgatagacagctttgttcggctaatgaatgagtttactaatatgccagtacct
ccaaaacccagacaagctcttggggataaaatcgtgagggatatccgccccggagctgcc
tttgaacccacgtatatttatagactcctgacagtgatcaagtcgagcctgtctgagaag
ggtcgacaagaagatgccgaagagtacttaggcttcattctaaatggactccatgaggaa
atgctgaacctaaagaagcttctctcaccaaataatgataaacttactatttccaatgga
cccaaaagccactcagtgaatgaagatgagcaggaagaaccaggagaaggaagtgaggac
gaatgggagcaagtgggtccccgaaacaagacctcagtcactcgccaggcggactttgtt
cagacccccatcactggcatttttggtggacacatcaggtctgtggtttaccagcagagt
tcaaaagagtctgccaccctgcagccgttcttcaccctgcagctggacatccagtccgac
aagatacgcaccgtgcaggacgcgctggagagcctggtggccagagagtctgtccagggt
tacaccaccaaaaccagacaagaggtggagatcagtcggagagtgaccctggagaagctc
cctcctgtgctcgtgctgcacctcaaacggtttgtctatgagaagaccggtggctgtcag
aagctcatcaaaaatatcgaatatcctgtggacttggaaattagtaaagaactgctctct
ccaggggttaaaaataagaactttaaatgccacagaacctataggctgtttgcagtggtc
taccaccacggcagcagcgccacgggcggccactacaccacggacgtcttccagatcggg
ctcaacggctggctgcgcatcgacgaccagacggtcaaggtggtcagccagcagcaggtg
gtgaggcccgccgccgagcgcacagcctacctcctgtactaccgccgcgtggacctgctg
tag

DBGET integrated database retrieval system